BLASTX nr result
ID: Mentha24_contig00020553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00020553 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34628.1| hypothetical protein MIMGU_mgv1a012132mg [Mimulus... 72 8e-11 ref|XP_004232182.1| PREDICTED: uncharacterized protein LOC101266... 70 2e-10 ref|XP_006338396.1| PREDICTED: uncharacterized protein LOC102594... 70 3e-10 gb|EPS68292.1| hypothetical protein M569_06482, partial [Genlise... 70 3e-10 ref|XP_004304259.1| PREDICTED: uncharacterized protein LOC101302... 70 3e-10 ref|XP_007215820.1| hypothetical protein PRUPE_ppa010047mg [Prun... 70 3e-10 emb|CBI15166.3| unnamed protein product [Vitis vinifera] 70 3e-10 ref|XP_002284521.1| PREDICTED: uncharacterized protein LOC100241... 70 3e-10 ref|XP_002306045.1| hypothetical protein POPTR_0004s12420g [Popu... 70 3e-10 ref|XP_002323884.1| hypothetical protein POPTR_0017s12580g [Popu... 70 3e-10 gb|EXB38058.1| hypothetical protein L484_020977 [Morus notabilis] 70 4e-10 ref|XP_006482702.1| PREDICTED: uncharacterized protein LOC102619... 70 4e-10 ref|XP_006431244.1| hypothetical protein CICLE_v10012457mg [Citr... 70 4e-10 ref|XP_006848735.1| hypothetical protein AMTR_s00177p00067830 [A... 70 4e-10 ref|XP_003531842.1| PREDICTED: uncharacterized protein LOC100811... 69 5e-10 ref|XP_003552550.1| PREDICTED: uncharacterized protein LOC100799... 69 5e-10 ref|XP_007139513.1| hypothetical protein PHAVU_008G036100g [Phas... 69 7e-10 ref|XP_007032660.1| RING/U-box superfamily protein isoform 2 [Th... 69 7e-10 ref|XP_007032659.1| RING/U-box superfamily protein isoform 1 [Th... 69 7e-10 gb|AFK39626.1| unknown [Lotus japonicus] 69 7e-10 >gb|EYU34628.1| hypothetical protein MIMGU_mgv1a012132mg [Mimulus guttatus] Length = 260 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALYI+ITVVFALPSFLILYFAYPSLDWLVREI+T Sbjct: 225 ILALYIIITVVFALPSFLILYFAYPSLDWLVREIIT 260 >ref|XP_004232182.1| PREDICTED: uncharacterized protein LOC101266380 isoform 1 [Solanum lycopersicum] gi|460372739|ref|XP_004232183.1| PREDICTED: uncharacterized protein LOC101266380 isoform 2 [Solanum lycopersicum] Length = 268 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 VLALY++ITVVFALPSFLILYFAYPSLDWLVREI+T Sbjct: 233 VLALYMLITVVFALPSFLILYFAYPSLDWLVREIIT 268 >ref|XP_006338396.1| PREDICTED: uncharacterized protein LOC102594483 isoform X1 [Solanum tuberosum] gi|565342528|ref|XP_006338397.1| PREDICTED: uncharacterized protein LOC102594483 isoform X2 [Solanum tuberosum] Length = 268 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALY++ITVVFALPSFLILYFAYPSLDWLVREI+T Sbjct: 233 ILALYMLITVVFALPSFLILYFAYPSLDWLVREIIT 268 >gb|EPS68292.1| hypothetical protein M569_06482, partial [Genlisea aurea] Length = 233 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALY+VITVVFALPSFL+LYFAYPSLDWLVREI+T Sbjct: 198 ILALYMVITVVFALPSFLMLYFAYPSLDWLVREIIT 233 >ref|XP_004304259.1| PREDICTED: uncharacterized protein LOC101302961 [Fragaria vesca subsp. vesca] Length = 266 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALYI+ITV+FALPSFLILYFAYPSLDWLVREI+T Sbjct: 231 ILALYILITVLFALPSFLILYFAYPSLDWLVREIIT 266 >ref|XP_007215820.1| hypothetical protein PRUPE_ppa010047mg [Prunus persica] gi|462411970|gb|EMJ17019.1| hypothetical protein PRUPE_ppa010047mg [Prunus persica] Length = 266 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALYI++TVVFALPSFL+LYFAYPSLDWLVREI+T Sbjct: 231 ILALYILVTVVFALPSFLLLYFAYPSLDWLVREIIT 266 >emb|CBI15166.3| unnamed protein product [Vitis vinifera] Length = 201 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALYI+ITV+FALPSFLILYFAYPSLDWLVREI+T Sbjct: 166 ILALYILITVLFALPSFLILYFAYPSLDWLVREIIT 201 >ref|XP_002284521.1| PREDICTED: uncharacterized protein LOC100241642 [Vitis vinifera] Length = 268 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALYI+ITV+FALPSFLILYFAYPSLDWLVREI+T Sbjct: 233 ILALYILITVLFALPSFLILYFAYPSLDWLVREIIT 268 >ref|XP_002306045.1| hypothetical protein POPTR_0004s12420g [Populus trichocarpa] gi|566166265|ref|XP_006384317.1| hypothetical protein POPTR_0004s12420g [Populus trichocarpa] gi|566166267|ref|XP_006384318.1| hypothetical protein POPTR_0004s12420g [Populus trichocarpa] gi|222849009|gb|EEE86556.1| hypothetical protein POPTR_0004s12420g [Populus trichocarpa] gi|550340895|gb|ERP62114.1| hypothetical protein POPTR_0004s12420g [Populus trichocarpa] gi|550340896|gb|ERP62115.1| hypothetical protein POPTR_0004s12420g [Populus trichocarpa] Length = 266 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALYI+ITV+FALPSFLILYFAYPSLDWLVREI+T Sbjct: 231 ILALYILITVLFALPSFLILYFAYPSLDWLVREIIT 266 >ref|XP_002323884.1| hypothetical protein POPTR_0017s12580g [Populus trichocarpa] gi|118481933|gb|ABK92900.1| unknown [Populus trichocarpa] gi|222866886|gb|EEF04017.1| hypothetical protein POPTR_0017s12580g [Populus trichocarpa] Length = 267 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALYI+ITV+FALPSFLILYFAYPSLDWLVREI+T Sbjct: 232 ILALYILITVLFALPSFLILYFAYPSLDWLVREIIT 267 >gb|EXB38058.1| hypothetical protein L484_020977 [Morus notabilis] Length = 268 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALYI++TV+FALPSFLILYFAYPSLDWLVREI+T Sbjct: 233 ILALYILVTVLFALPSFLILYFAYPSLDWLVREIIT 268 >ref|XP_006482702.1| PREDICTED: uncharacterized protein LOC102619415 [Citrus sinensis] Length = 273 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALYI++T++FALPSFLILYFAYPSLDWLVREIVT Sbjct: 238 ILALYILVTILFALPSFLILYFAYPSLDWLVREIVT 273 >ref|XP_006431244.1| hypothetical protein CICLE_v10012457mg [Citrus clementina] gi|557533301|gb|ESR44484.1| hypothetical protein CICLE_v10012457mg [Citrus clementina] Length = 272 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALYI++T++FALPSFLILYFAYPSLDWLVREIVT Sbjct: 237 ILALYILVTILFALPSFLILYFAYPSLDWLVREIVT 272 >ref|XP_006848735.1| hypothetical protein AMTR_s00177p00067830 [Amborella trichopoda] gi|548852146|gb|ERN10316.1| hypothetical protein AMTR_s00177p00067830 [Amborella trichopoda] Length = 262 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALY+++TV+FALPSFLILYFAYPSLDWLVREIVT Sbjct: 227 ILALYVLVTVLFALPSFLILYFAYPSLDWLVREIVT 262 >ref|XP_003531842.1| PREDICTED: uncharacterized protein LOC100811549 isoform 2 [Glycine max] Length = 267 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALYI++T++FALPSFLILYFAYPSLDWLVREI+T Sbjct: 232 ILALYILVTILFALPSFLILYFAYPSLDWLVREIIT 267 >ref|XP_003552550.1| PREDICTED: uncharacterized protein LOC100799346 isoformX1 [Glycine max] gi|356568706|ref|XP_003552551.1| PREDICTED: uncharacterized protein LOC100799346 isoformX2 [Glycine max] gi|571549326|ref|XP_006602934.1| PREDICTED: uncharacterized protein LOC100799346 isoform X3 [Glycine max] gi|571549330|ref|XP_006602935.1| PREDICTED: uncharacterized protein LOC100799346 isoform X4 [Glycine max] Length = 266 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALYI++T++FALPSFLILYFAYPSLDWLVREI+T Sbjct: 231 ILALYILVTILFALPSFLILYFAYPSLDWLVREIIT 266 >ref|XP_007139513.1| hypothetical protein PHAVU_008G036100g [Phaseolus vulgaris] gi|593332177|ref|XP_007139514.1| hypothetical protein PHAVU_008G036100g [Phaseolus vulgaris] gi|561012646|gb|ESW11507.1| hypothetical protein PHAVU_008G036100g [Phaseolus vulgaris] gi|561012647|gb|ESW11508.1| hypothetical protein PHAVU_008G036100g [Phaseolus vulgaris] Length = 266 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIV 328 +LALYI++TVVFALPSFLILYFAYPSLDWLVREI+ Sbjct: 231 ILALYILVTVVFALPSFLILYFAYPSLDWLVREII 265 >ref|XP_007032660.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao] gi|508711689|gb|EOY03586.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao] Length = 267 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALYI+ITV+FALPSFLILYFAYPSLDWLV+EI+T Sbjct: 232 ILALYILITVLFALPSFLILYFAYPSLDWLVKEIIT 267 >ref|XP_007032659.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao] gi|508711688|gb|EOY03585.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao] Length = 303 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIVT 325 +LALYI+ITV+FALPSFLILYFAYPSLDWLV+EI+T Sbjct: 268 ILALYILITVLFALPSFLILYFAYPSLDWLVKEIIT 303 >gb|AFK39626.1| unknown [Lotus japonicus] Length = 266 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = -1 Query: 432 VLALYIVITVVFALPSFLILYFAYPSLDWLVREIV 328 +LALYIVIT++FALPSFLILYFAYPSLDWLVREI+ Sbjct: 231 ILALYIVITILFALPSFLILYFAYPSLDWLVREII 265