BLASTX nr result
ID: Mentha24_contig00019863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00019863 (594 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27641.1| hypothetical protein MIMGU_mgv1a000583mg [Mimulus... 148 1e-33 ref|XP_006350247.1| PREDICTED: C2 and GRAM domain-containing pro... 147 2e-33 ref|XP_006350246.1| PREDICTED: C2 and GRAM domain-containing pro... 147 2e-33 ref|XP_004236646.1| PREDICTED: C2 and GRAM domain-containing pro... 145 8e-33 gb|EPS70354.1| hypothetical protein M569_04402, partial [Genlise... 135 9e-30 ref|XP_002889456.1| C2 domain-containing protein [Arabidopsis ly... 133 4e-29 ref|XP_006467213.1| PREDICTED: C2 and GRAM domain-containing pro... 132 9e-29 ref|XP_007147576.1| hypothetical protein PHAVU_006G136200g [Phas... 131 1e-28 ref|XP_007026402.1| C2 calcium/lipid-binding and GRAM domain con... 129 5e-28 ref|NP_171836.3| C2 calcium/lipid-binding and GRAM domain contai... 129 6e-28 ref|XP_006398485.1| hypothetical protein EUTSA_v10000756mg [Eutr... 128 1e-27 ref|XP_006306660.1| hypothetical protein CARUB_v10008175mg [Caps... 128 1e-27 ref|XP_004172925.1| PREDICTED: C2 and GRAM domain-containing pro... 127 2e-27 ref|XP_004139509.1| PREDICTED: C2 and GRAM domain-containing pro... 127 2e-27 ref|XP_002308750.1| C2 domain-containing family protein [Populus... 127 2e-27 ref|XP_003546208.1| PREDICTED: C2 and GRAM domain-containing pro... 126 4e-27 ref|XP_002264782.2| PREDICTED: C2 and GRAM domain-containing pro... 126 4e-27 gb|EXB64608.1| C2 and GRAM domain-containing protein [Morus nota... 126 5e-27 ref|XP_003594332.1| Synaptotagmin-1 [Medicago truncatula] gi|355... 125 7e-27 ref|XP_006373576.1| hypothetical protein POPTR_0016s00550g [Popu... 122 6e-26 >gb|EYU27641.1| hypothetical protein MIMGU_mgv1a000583mg [Mimulus guttatus] Length = 1058 Score = 148 bits (374), Expect = 1e-33 Identities = 70/78 (89%), Positives = 76/78 (97%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 M+LLVRVIEA+NIPALDPNGFSDPYVKLQLGKQR++SKVVKK LNPSWCEEFIFKVDDLK Sbjct: 1 MQLLVRVIEAKNIPALDPNGFSDPYVKLQLGKQRYKSKVVKKCLNPSWCEEFIFKVDDLK 60 Query: 56 EELLLTVLDEDKYFNDDF 3 +ELL+ VLDEDKYFNDDF Sbjct: 61 DELLICVLDEDKYFNDDF 78 >ref|XP_006350247.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like isoform X2 [Solanum tuberosum] Length = 893 Score = 147 bits (372), Expect = 2e-33 Identities = 69/78 (88%), Positives = 75/78 (96%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKLLVRVIEARNIPA+DPNGFSDPYVKL LGKQ+F+SKVVKK LNPSWCEEF FKVDDLK Sbjct: 1 MKLLVRVIEARNIPAMDPNGFSDPYVKLSLGKQKFKSKVVKKCLNPSWCEEFAFKVDDLK 60 Query: 56 EELLLTVLDEDKYFNDDF 3 EEL+++VLDEDKYFNDDF Sbjct: 61 EELIISVLDEDKYFNDDF 78 >ref|XP_006350246.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like isoform X1 [Solanum tuberosum] Length = 1052 Score = 147 bits (372), Expect = 2e-33 Identities = 69/78 (88%), Positives = 75/78 (96%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKLLVRVIEARNIPA+DPNGFSDPYVKL LGKQ+F+SKVVKK LNPSWCEEF FKVDDLK Sbjct: 1 MKLLVRVIEARNIPAMDPNGFSDPYVKLSLGKQKFKSKVVKKCLNPSWCEEFAFKVDDLK 60 Query: 56 EELLLTVLDEDKYFNDDF 3 EEL+++VLDEDKYFNDDF Sbjct: 61 EELIISVLDEDKYFNDDF 78 >ref|XP_004236646.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Solanum lycopersicum] Length = 1029 Score = 145 bits (366), Expect = 8e-33 Identities = 68/78 (87%), Positives = 74/78 (94%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKLLVRVIEARNIPA+DPNGFSDPYVKL LGKQ+F+SKVVKK LNPSWCEEF F+VDDLK Sbjct: 1 MKLLVRVIEARNIPAMDPNGFSDPYVKLSLGKQKFKSKVVKKCLNPSWCEEFAFRVDDLK 60 Query: 56 EELLLTVLDEDKYFNDDF 3 EEL ++VLDEDKYFNDDF Sbjct: 61 EELTISVLDEDKYFNDDF 78 >gb|EPS70354.1| hypothetical protein M569_04402, partial [Genlisea aurea] Length = 1011 Score = 135 bits (340), Expect = 9e-30 Identities = 63/78 (80%), Positives = 72/78 (92%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKL +RVIEARNIPALD NGFSDPYVKLQLG+Q+FR+KVVKK+LNPSWCEEF FKVDDL+ Sbjct: 1 MKLFIRVIEARNIPALDSNGFSDPYVKLQLGRQKFRTKVVKKSLNPSWCEEFTFKVDDLE 60 Query: 56 EELLLTVLDEDKYFNDDF 3 EE+L++VLD DKY DDF Sbjct: 61 EEILVSVLDADKYSYDDF 78 >ref|XP_002889456.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335298|gb|EFH65715.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1872 Score = 133 bits (334), Expect = 4e-29 Identities = 62/80 (77%), Positives = 72/80 (90%) Frame = -2 Query: 242 VEMKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDD 63 VEMKL VRV+EARN+PA+D NGFSDPYV+LQLGKQR R+KVVKKNLNP W E+F F VDD Sbjct: 835 VEMKLQVRVVEARNLPAMDLNGFSDPYVRLQLGKQRSRTKVVKKNLNPKWAEDFSFGVDD 894 Query: 62 LKEELLLTVLDEDKYFNDDF 3 L +EL+++VLDEDKYFNDDF Sbjct: 895 LNDELVVSVLDEDKYFNDDF 914 >ref|XP_006467213.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Citrus sinensis] Length = 1016 Score = 132 bits (331), Expect = 9e-29 Identities = 60/78 (76%), Positives = 75/78 (96%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKL+VRVIEARNIPA+D NG+SDPYV+LQLG+QRF++KVV+K+L+PSW EEF FKV+DLK Sbjct: 1 MKLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLK 60 Query: 56 EELLLTVLDEDKYFNDDF 3 +EL+++VLDEDKYFNDDF Sbjct: 61 DELVISVLDEDKYFNDDF 78 >ref|XP_007147576.1| hypothetical protein PHAVU_006G136200g [Phaseolus vulgaris] gi|561020799|gb|ESW19570.1| hypothetical protein PHAVU_006G136200g [Phaseolus vulgaris] Length = 1016 Score = 131 bits (330), Expect = 1e-28 Identities = 59/78 (75%), Positives = 71/78 (91%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKL+VRVIEA+N+P DPNG SDPYV+LQLGKQRFR+KV+KKNLNP W EE+ F+VDDL Sbjct: 1 MKLVVRVIEAKNLPPTDPNGLSDPYVRLQLGKQRFRTKVIKKNLNPKWNEEYSFRVDDLN 60 Query: 56 EELLLTVLDEDKYFNDDF 3 EEL+L+V+DEDK+FNDDF Sbjct: 61 EELVLSVMDEDKFFNDDF 78 >ref|XP_007026402.1| C2 calcium/lipid-binding and GRAM domain containing protein [Theobroma cacao] gi|508781768|gb|EOY29024.1| C2 calcium/lipid-binding and GRAM domain containing protein [Theobroma cacao] Length = 1025 Score = 129 bits (325), Expect = 5e-28 Identities = 62/78 (79%), Positives = 70/78 (89%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKL+V VIEARN+P +D NGFSDPYVKLQLGKQR R+KVVKK LNP+W EEF FKV+DL Sbjct: 1 MKLIVGVIEARNMPPMDINGFSDPYVKLQLGKQRSRTKVVKKTLNPTWGEEFSFKVEDLN 60 Query: 56 EELLLTVLDEDKYFNDDF 3 EELL++VLDEDKYFNDDF Sbjct: 61 EELLISVLDEDKYFNDDF 78 >ref|NP_171836.3| C2 calcium/lipid-binding and GRAM domain containing protein [Arabidopsis thaliana] gi|75315948|sp|Q9ZVT9.4|C2GR1_ARATH RecName: Full=C2 and GRAM domain-containing protein At1g03370 gi|15778696|gb|AAC72128.2| Contains similarity to gb|AB011110 KIAA0538 protein from Homo sapiens brain and to phospholipid-binding domain C2 PF|00168. ESTs gb|AA585988 and gb|T04384 come from this gene [Arabidopsis thaliana] gi|21539553|gb|AAM53329.1| unknown protein [Arabidopsis thaliana] gi|332189444|gb|AEE27565.1| C2 calcium/lipid-binding and GRAM domain containing protein [Arabidopsis thaliana] Length = 1020 Score = 129 bits (324), Expect = 6e-28 Identities = 60/78 (76%), Positives = 70/78 (89%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKL VRV+EARN+PA+D NGFSDPYV+LQLGKQR R+KVVKKNLNP W E+F F VDDL Sbjct: 1 MKLQVRVVEARNLPAMDLNGFSDPYVRLQLGKQRSRTKVVKKNLNPKWTEDFSFGVDDLN 60 Query: 56 EELLLTVLDEDKYFNDDF 3 +EL+++VLDEDKYFNDDF Sbjct: 61 DELVVSVLDEDKYFNDDF 78 >ref|XP_006398485.1| hypothetical protein EUTSA_v10000756mg [Eutrema salsugineum] gi|557099574|gb|ESQ39938.1| hypothetical protein EUTSA_v10000756mg [Eutrema salsugineum] Length = 1020 Score = 128 bits (321), Expect = 1e-27 Identities = 59/78 (75%), Positives = 70/78 (89%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKL VRV+EARN+PA+D NG+SDPYV+LQLGKQR R+KVVKKNLNP W ++F F VDDL Sbjct: 1 MKLQVRVLEARNLPAMDLNGYSDPYVRLQLGKQRSRTKVVKKNLNPKWADDFSFGVDDLN 60 Query: 56 EELLLTVLDEDKYFNDDF 3 EEL+++VLDEDKYFNDDF Sbjct: 61 EELVVSVLDEDKYFNDDF 78 >ref|XP_006306660.1| hypothetical protein CARUB_v10008175mg [Capsella rubella] gi|482575371|gb|EOA39558.1| hypothetical protein CARUB_v10008175mg [Capsella rubella] Length = 1024 Score = 128 bits (321), Expect = 1e-27 Identities = 59/78 (75%), Positives = 70/78 (89%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKL VRV+EARN+PA+D NGFSDPYV+LQLGKQR R+KVVKKNLNP W ++F F VDDL Sbjct: 1 MKLQVRVLEARNLPAMDLNGFSDPYVRLQLGKQRSRTKVVKKNLNPKWADDFSFGVDDLN 60 Query: 56 EELLLTVLDEDKYFNDDF 3 +EL+++VLDEDKYFNDDF Sbjct: 61 DELVVSVLDEDKYFNDDF 78 >ref|XP_004172925.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like, partial [Cucumis sativus] Length = 870 Score = 127 bits (319), Expect = 2e-27 Identities = 60/78 (76%), Positives = 68/78 (87%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKL V VIEARN+P D NG SDPYV+LQLGKQRFR+KVVKK LNP+W EEF F+VDDL Sbjct: 8 MKLTVHVIEARNLPPTDLNGLSDPYVRLQLGKQRFRTKVVKKTLNPTWGEEFSFRVDDLD 67 Query: 56 EELLLTVLDEDKYFNDDF 3 EEL+++VLDEDKYFNDDF Sbjct: 68 EELMISVLDEDKYFNDDF 85 >ref|XP_004139509.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Cucumis sativus] Length = 1034 Score = 127 bits (319), Expect = 2e-27 Identities = 60/78 (76%), Positives = 68/78 (87%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKL V VIEARN+P D NG SDPYV+LQLGKQRFR+KVVKK LNP+W EEF F+VDDL Sbjct: 8 MKLTVHVIEARNLPPTDLNGLSDPYVRLQLGKQRFRTKVVKKTLNPTWGEEFSFRVDDLD 67 Query: 56 EELLLTVLDEDKYFNDDF 3 EEL+++VLDEDKYFNDDF Sbjct: 68 EELMISVLDEDKYFNDDF 85 >ref|XP_002308750.1| C2 domain-containing family protein [Populus trichocarpa] gi|222854726|gb|EEE92273.1| C2 domain-containing family protein [Populus trichocarpa] Length = 1012 Score = 127 bits (319), Expect = 2e-27 Identities = 59/77 (76%), Positives = 68/77 (88%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKL+VR+IEARN+P DPNG DPY KLQLGKQ+F++KVVKKNLNPSW EEF FKV+DL Sbjct: 4 MKLVVRLIEARNLPPTDPNGLRDPYAKLQLGKQKFKTKVVKKNLNPSWGEEFSFKVEDLN 63 Query: 56 EELLLTVLDEDKYFNDD 6 EEL++ VLDEDKYFNDD Sbjct: 64 EELVVGVLDEDKYFNDD 80 >ref|XP_003546208.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like isoform X1 [Glycine max] Length = 1018 Score = 126 bits (317), Expect = 4e-27 Identities = 57/78 (73%), Positives = 69/78 (88%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKL+VRVIEA+N+P DPNG SDPYV+LQLGK RFR+KV+KK LNP W EEF F+VDDL Sbjct: 1 MKLVVRVIEAKNLPPTDPNGLSDPYVRLQLGKHRFRTKVIKKCLNPKWDEEFSFRVDDLN 60 Query: 56 EELLLTVLDEDKYFNDDF 3 EEL+++V+DEDK+FNDDF Sbjct: 61 EELVISVMDEDKFFNDDF 78 >ref|XP_002264782.2| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Vitis vinifera] gi|297736702|emb|CBI25738.3| unnamed protein product [Vitis vinifera] Length = 1030 Score = 126 bits (317), Expect = 4e-27 Identities = 59/78 (75%), Positives = 71/78 (91%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKL+VRVIEARN+PA+D NG SDPYV+LQLG+ RFR+KVVKK+LNPSW EEF F V+DL Sbjct: 1 MKLVVRVIEARNLPAMDLNGLSDPYVRLQLGRNRFRTKVVKKSLNPSWGEEFSFWVEDLS 60 Query: 56 EELLLTVLDEDKYFNDDF 3 E+L+++VLDEDKYFNDDF Sbjct: 61 EDLVVSVLDEDKYFNDDF 78 >gb|EXB64608.1| C2 and GRAM domain-containing protein [Morus notabilis] Length = 988 Score = 126 bits (316), Expect = 5e-27 Identities = 59/78 (75%), Positives = 71/78 (91%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKL+VRV+EARN+PA+D NG SDPYVKLQLGKQR ++KVVKK+L P W EEF F+V+DLK Sbjct: 1 MKLVVRVMEARNLPAMDLNGLSDPYVKLQLGKQRSKTKVVKKSLKPCWGEEFSFRVEDLK 60 Query: 56 EELLLTVLDEDKYFNDDF 3 EEL+++VLDEDKYFNDDF Sbjct: 61 EELVVSVLDEDKYFNDDF 78 >ref|XP_003594332.1| Synaptotagmin-1 [Medicago truncatula] gi|355483380|gb|AES64583.1| Synaptotagmin-1 [Medicago truncatula] Length = 1042 Score = 125 bits (315), Expect = 7e-27 Identities = 58/78 (74%), Positives = 69/78 (88%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 MKL+VRVIEA N+P DPNG SDPYV+LQLGKQRFR+KV+KK+LNP W EEF FKVDDLK Sbjct: 1 MKLVVRVIEAMNLPPTDPNGLSDPYVRLQLGKQRFRTKVIKKSLNPKWDEEFSFKVDDLK 60 Query: 56 EELLLTVLDEDKYFNDDF 3 EEL+++V+DEDK+ DDF Sbjct: 61 EELVVSVMDEDKFLIDDF 78 >ref|XP_006373576.1| hypothetical protein POPTR_0016s00550g [Populus trichocarpa] gi|550320487|gb|ERP51373.1| hypothetical protein POPTR_0016s00550g [Populus trichocarpa] Length = 960 Score = 122 bits (307), Expect = 6e-26 Identities = 56/78 (71%), Positives = 68/78 (87%) Frame = -2 Query: 236 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKNLNPSWCEEFIFKVDDLK 57 ++L VRVIEARN+P DPNG SDPY KL+LGKQ+ ++KVVKKNLNPSW EEF FKV+DL Sbjct: 4 LRLFVRVIEARNLPPTDPNGLSDPYAKLRLGKQKCKTKVVKKNLNPSWEEEFSFKVEDLN 63 Query: 56 EELLLTVLDEDKYFNDDF 3 E+L++ VLDEDK+FNDDF Sbjct: 64 EDLVVCVLDEDKFFNDDF 81