BLASTX nr result
ID: Mentha24_contig00019795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00019795 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38837.1| hypothetical protein MIMGU_mgv1a0003451mg, partia... 58 1e-06 >gb|EYU38837.1| hypothetical protein MIMGU_mgv1a0003451mg, partial [Mimulus guttatus] Length = 664 Score = 58.2 bits (139), Expect = 1e-06 Identities = 37/89 (41%), Positives = 47/89 (52%), Gaps = 14/89 (15%) Frame = +1 Query: 37 YPGGDRAVIQPSSGYSHHRPPSSTPYRQ-PYVSQP------QNTH-IRFQNHQNEVHEIP 192 YP G+ A+ Q S YSHHRP SS PYRQ PY + P N H RF + + + P Sbjct: 467 YPAGEVAM-QTSPVYSHHRPSSSVPYRQPPYAAAPPPPPTHHNPHNNRFPDSRYGSDDRP 525 Query: 193 VPHVREYNRHGYYP------QVPPQHNGH 261 H R+ RHG+Y Q PPQ +G+ Sbjct: 526 ATHARDNPRHGHYAQGGRHGQAPPQQHGY 554