BLASTX nr result
ID: Mentha24_contig00019774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00019774 (546 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46373.1| hypothetical protein MIMGU_mgv1a014667mg [Mimulus... 102 8e-20 gb|EYU17959.1| hypothetical protein MIMGU_mgv1a014885mg [Mimulus... 99 9e-19 pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12... 97 2e-18 gb|ACJ60637.1| glutaredoxin S12 [Populus tremula x Populus tremu... 97 2e-18 ref|XP_006386902.1| hypothetical protein POPTR_0002s25540g [Popu... 97 2e-18 ref|XP_004290010.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 96 4e-18 ref|NP_001238538.1| uncharacterized protein LOC100305906 [Glycin... 94 2e-17 ref|XP_004140671.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 94 2e-17 ref|XP_002267052.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 94 2e-17 emb|CBI37229.3| unnamed protein product [Vitis vinifera] 94 2e-17 gb|ACF74281.1| electron transporter/thiol-disulfide exchange int... 93 5e-17 gb|AFK37707.1| unknown [Lotus japonicus] 92 6e-17 ref|XP_007201404.1| hypothetical protein PRUPE_ppa012249mg [Prun... 92 1e-16 ref|XP_007144429.1| hypothetical protein PHAVU_007G155300g [Phas... 91 1e-16 gb|EXB46054.1| Glutaredoxin-C5 [Morus notabilis] 91 2e-16 ref|XP_003542446.2| PREDICTED: glutaredoxin-C5, chloroplastic is... 91 2e-16 ref|XP_006443689.1| hypothetical protein CICLE_v10022530mg [Citr... 91 2e-16 ref|XP_004168592.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 91 2e-16 ref|XP_006352722.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 89 5e-16 ref|XP_004242377.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 89 5e-16 >gb|EYU46373.1| hypothetical protein MIMGU_mgv1a014667mg [Mimulus guttatus] Length = 182 Score = 102 bits (253), Expect = 8e-20 Identities = 59/122 (48%), Positives = 67/122 (54%), Gaps = 16/122 (13%) Frame = -3 Query: 490 KNTGLLSIRAMSSDSFGPGPQ----------------LEXXXXXXXXXXXXXXXXXXXXX 359 KN GL IRAM SDS G G + Sbjct: 58 KNAGLRQIRAMGSDSSGSGLEDTVKKTIVDNPVVVYSKTWCSYSSEVKSLFKRLGAETLV 117 Query: 358 XXXXXLGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGA 179 LG+QG+QLQKTLE LTGQHTVPNVFIGGKHIGGC+D + L+QKGEL+ LLS+AGA Sbjct: 118 IELDQLGSQGAQLQKTLESLTGQHTVPNVFIGGKHIGGCTDTVKLYQKGELESLLSQAGA 177 Query: 178 TK 173 TK Sbjct: 178 TK 179 >gb|EYU17959.1| hypothetical protein MIMGU_mgv1a014885mg [Mimulus guttatus] Length = 174 Score = 98.6 bits (244), Expect = 9e-19 Identities = 44/57 (77%), Positives = 52/57 (91%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGATK 173 LGAQG QLQ+TL++LTGQHTVPNVF+GGKHIGGC+D + LH+KGEL+PLLSEA A K Sbjct: 118 LGAQGPQLQRTLKRLTGQHTVPNVFVGGKHIGGCTDTVKLHRKGELEPLLSEAVANK 174 >pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex With Glutathione gi|224036433|pdb|3FZA|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex With Glutathione And Beta-Mercaptoethanol Length = 112 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/57 (77%), Positives = 51/57 (89%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGATK 173 LGAQG Q+QK LE+LTGQHTVPNVFIGGKHIGGC+D + L++KGEL+PLLSEA A K Sbjct: 53 LGAQGPQIQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEANAKK 109 >gb|ACJ60637.1| glutaredoxin S12 [Populus tremula x Populus tremuloides] Length = 185 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/57 (77%), Positives = 51/57 (89%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGATK 173 LGAQG Q+QK LE+LTGQHTVPNVFIGGKHIGGC+D + L++KGEL+PLLSEA A K Sbjct: 126 LGAQGPQIQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEANAKK 182 >ref|XP_006386902.1| hypothetical protein POPTR_0002s25540g [Populus trichocarpa] gi|118483275|gb|ABK93540.1| unknown [Populus trichocarpa] gi|550345807|gb|ERP64699.1| hypothetical protein POPTR_0002s25540g [Populus trichocarpa] Length = 185 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/57 (77%), Positives = 51/57 (89%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGATK 173 LGAQG Q+QK LE+LTGQHTVPNVFIGGKHIGGC+D + L++KGEL+PLLSEA A K Sbjct: 126 LGAQGPQIQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEANAKK 182 >ref|XP_004290010.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 171 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEA 185 LGAQG QLQK LE+LTGQHTVPNVFIGGKHIGGC+D + LH+KGEL+PLL+EA Sbjct: 112 LGAQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLHRKGELEPLLAEA 164 >ref|NP_001238538.1| uncharacterized protein LOC100305906 [Glycine max] gi|255626941|gb|ACU13815.1| unknown [Glycine max] Length = 166 Score = 94.4 bits (233), Expect = 2e-17 Identities = 42/57 (73%), Positives = 50/57 (87%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGATK 173 +G QG QLQK LE++TGQHTVPNVFIGGKHIGGC+D + L++KGEL+PLLSEA A K Sbjct: 107 MGPQGPQLQKVLERITGQHTVPNVFIGGKHIGGCTDTLKLYRKGELEPLLSEANAKK 163 >ref|XP_004140671.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Cucumis sativus] Length = 120 Score = 94.0 bits (232), Expect = 2e-17 Identities = 42/55 (76%), Positives = 49/55 (89%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGA 179 LG QG QLQK LE+LTGQHTVPNVFIGGKHIGGC+D + L++KGEL+P+LSEA A Sbjct: 61 LGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPMLSEANA 115 >ref|XP_002267052.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Vitis vinifera] Length = 178 Score = 94.0 bits (232), Expect = 2e-17 Identities = 42/57 (73%), Positives = 49/57 (85%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGATK 173 +G QG QLQK LE+LTGQHTVPNVFIGGKHIGGC+D + L++KGEL+PLLSEA K Sbjct: 119 MGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEASTRK 175 >emb|CBI37229.3| unnamed protein product [Vitis vinifera] Length = 114 Score = 94.0 bits (232), Expect = 2e-17 Identities = 42/57 (73%), Positives = 49/57 (85%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGATK 173 +G QG QLQK LE+LTGQHTVPNVFIGGKHIGGC+D + L++KGEL+PLLSEA K Sbjct: 55 MGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEASTRK 111 >gb|ACF74281.1| electron transporter/thiol-disulfide exchange intermediate protein [Arachis hypogaea] Length = 187 Score = 92.8 bits (229), Expect = 5e-17 Identities = 42/55 (76%), Positives = 49/55 (89%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGA 179 +G QG QLQK LE+LTGQHTVPNVFIGGKHIGGC+D + L++KGEL+PLLSEA A Sbjct: 129 MGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTLKLYRKGELEPLLSEATA 183 >gb|AFK37707.1| unknown [Lotus japonicus] Length = 182 Score = 92.4 bits (228), Expect = 6e-17 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGA 179 +G QG QLQK LE+LTGQHTVPNVFIGGKHIGGC+D + LH GEL+PLLSEA A Sbjct: 123 MGPQGPQLQKMLERLTGQHTVPNVFIGGKHIGGCTDTLKLHHNGELEPLLSEAKA 177 >ref|XP_007201404.1| hypothetical protein PRUPE_ppa012249mg [Prunus persica] gi|462396804|gb|EMJ02603.1| hypothetical protein PRUPE_ppa012249mg [Prunus persica] Length = 178 Score = 91.7 bits (226), Expect = 1e-16 Identities = 42/55 (76%), Positives = 48/55 (87%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGA 179 LG QG QLQK LE+LTGQHTVPNVFI GKHIGGC+D + L++KGEL+PLLSEA A Sbjct: 119 LGPQGPQLQKVLERLTGQHTVPNVFIAGKHIGGCTDTVKLYRKGELEPLLSEAKA 173 >ref|XP_007144429.1| hypothetical protein PHAVU_007G155300g [Phaseolus vulgaris] gi|561017619|gb|ESW16423.1| hypothetical protein PHAVU_007G155300g [Phaseolus vulgaris] Length = 226 Score = 91.3 bits (225), Expect = 1e-16 Identities = 41/53 (77%), Positives = 48/53 (90%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEA 185 +G QG QLQK LE++TGQHTVPNVFIGGKHIGGCSD + L++KGEL+PLLSEA Sbjct: 167 MGPQGPQLQKGLERITGQHTVPNVFIGGKHIGGCSDTMKLYRKGELEPLLSEA 219 >gb|EXB46054.1| Glutaredoxin-C5 [Morus notabilis] Length = 176 Score = 90.9 bits (224), Expect = 2e-16 Identities = 39/53 (73%), Positives = 47/53 (88%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEA 185 +GAQG Q+QK LE+LTGQHTVPNVF+GG HIGGCS+ + LH KGEL+PLL+EA Sbjct: 118 MGAQGPQVQKLLERLTGQHTVPNVFVGGNHIGGCSETVKLHHKGELEPLLAEA 170 >ref|XP_003542446.2| PREDICTED: glutaredoxin-C5, chloroplastic isoform X1 [Glycine max] Length = 177 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/57 (70%), Positives = 49/57 (85%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGATK 173 +G QG QL K LE++TGQHTVPNVFIGGKHIGGC+D + L++KGEL+PLLS+A A K Sbjct: 118 MGPQGPQLHKVLERITGQHTVPNVFIGGKHIGGCTDTLKLYRKGELEPLLSKANAKK 174 >ref|XP_006443689.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|567902404|ref|XP_006443690.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|567902406|ref|XP_006443691.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|568853006|ref|XP_006480159.1| PREDICTED: glutaredoxin-C5, chloroplastic-like isoform X1 [Citrus sinensis] gi|557545951|gb|ESR56929.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|557545952|gb|ESR56930.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|557545953|gb|ESR56931.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] Length = 174 Score = 90.5 bits (223), Expect = 2e-16 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEA 185 +G QG QLQK LE+LTGQHTVPNVFIGGKHIGGC++ + L++KGEL+PLLSEA Sbjct: 117 MGPQGPQLQKLLERLTGQHTVPNVFIGGKHIGGCTETVKLYRKGELEPLLSEA 169 >ref|XP_004168592.1| PREDICTED: glutaredoxin-C5, chloroplastic-like, partial [Cucumis sativus] Length = 58 Score = 90.5 bits (223), Expect = 2e-16 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = -3 Query: 334 QGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGA 179 QG QLQK LE+LTGQHTVPNVFIGGKHIGGC+D + L++KGEL+P+LSEA A Sbjct: 2 QGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPMLSEANA 53 >ref|XP_006352722.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Solanum tuberosum] Length = 183 Score = 89.4 bits (220), Expect = 5e-16 Identities = 42/57 (73%), Positives = 48/57 (84%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGATK 173 +G QG QLQK LE+LTGQHTVPNVFIG KHIGGC+D I L++KGEL+ LLSEA A K Sbjct: 124 MGPQGPQLQKVLERLTGQHTVPNVFIGAKHIGGCTDTIKLYRKGELESLLSEAKAGK 180 >ref|XP_004242377.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Solanum lycopersicum] Length = 183 Score = 89.4 bits (220), Expect = 5e-16 Identities = 42/57 (73%), Positives = 48/57 (84%) Frame = -3 Query: 343 LGAQGSQLQKTLEKLTGQHTVPNVFIGGKHIGGCSDAINLHQKGELQPLLSEAGATK 173 +G QG QLQK LE+LTGQHTVPNVFIG KHIGGC+D I L++KGEL+ LLSEA A K Sbjct: 124 MGPQGPQLQKVLERLTGQHTVPNVFIGAKHIGGCTDTIKLYRKGELESLLSEAKAGK 180