BLASTX nr result
ID: Mentha24_contig00019732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00019732 (453 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN08757.1| hypothetical protein MtrDRAFT_AC160012g12v2 [Medi... 55 1e-05 >gb|ABN08757.1| hypothetical protein MtrDRAFT_AC160012g12v2 [Medicago truncatula] Length = 51 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = +2 Query: 14 EIMKQKGQNNFNSPHMKKNALLRQGSLPTNLEVPQHLVMEAIDHL 148 EIMK KG N++ +PHM+K+AL RQ LPT L+ HLV E +++L Sbjct: 3 EIMKAKGNNDYKAPHMQKDALFRQDKLPTTLDCDWHLVTETMEYL 47