BLASTX nr result
ID: Mentha24_contig00019645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00019645 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42249.1| hypothetical protein MIMGU_mgv1a017270mg [Mimulus... 78 1e-12 >gb|EYU42249.1| hypothetical protein MIMGU_mgv1a017270mg [Mimulus guttatus] Length = 85 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +3 Query: 3 RSHSFKTARTLSIRRWAAALADIPAGSESSPTSMGFFRSFSRKD 134 RSHSFKTARTLSIRRWAAAL+DIPAG ESSP+ GF RSFSR+D Sbjct: 42 RSHSFKTARTLSIRRWAAALSDIPAGGESSPSPRGFLRSFSRRD 85