BLASTX nr result
ID: Mentha24_contig00019470
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00019470 (403 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28026.1| hypothetical protein MIMGU_mgv1a005469mg [Mimulus... 57 3e-06 ref|XP_007213960.1| hypothetical protein PRUPE_ppa004946mg [Prun... 56 4e-06 >gb|EYU28026.1| hypothetical protein MIMGU_mgv1a005469mg [Mimulus guttatus] Length = 482 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/70 (48%), Positives = 41/70 (58%), Gaps = 12/70 (17%) Frame = +3 Query: 3 LSAEFP-----NEKQRIVKGRGTSNLKEGNGRGVYSGPPNALGASPGE-------PFDYL 146 L+AEFP NEKQ+ VKGRG +N K N NAL A+PG+ P DYL Sbjct: 422 LTAEFPIEKQKNEKQKSVKGRGKNNSKASN---------NALAANPGKGVVVDNTPCDYL 472 Query: 147 VDDINGYYIT 176 VDD+ GYY+T Sbjct: 473 VDDVGGYYLT 482 >ref|XP_007213960.1| hypothetical protein PRUPE_ppa004946mg [Prunus persica] gi|595904150|ref|XP_007213961.1| hypothetical protein PRUPE_ppa004946mg [Prunus persica] gi|462409825|gb|EMJ15159.1| hypothetical protein PRUPE_ppa004946mg [Prunus persica] gi|462409826|gb|EMJ15160.1| hypothetical protein PRUPE_ppa004946mg [Prunus persica] Length = 484 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 7/65 (10%) Frame = +3 Query: 3 LSAEFPNEKQRIVKGRGTSNLKEGNGRGVYSGPPNALGASP-------GEPFDYLVDDIN 161 LSAEFP++ +R VKGR +N K G G Y+ PN G + G P+DYLV+++N Sbjct: 422 LSAEFPSDNKRCVKGRAKANEKVGVGNVYYT--PNRGGTTNGTFDYGIGAPYDYLVENVN 479 Query: 162 GYYIT 176 GYY+T Sbjct: 480 GYYLT 484