BLASTX nr result
ID: Mentha24_contig00019286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00019286 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46369.1| hypothetical protein MIMGU_mgv1a0120571mg, partia... 68 2e-09 ref|XP_004495030.1| PREDICTED: tetraspanin-20-like [Cicer arieti... 60 3e-07 >gb|EYU46369.1| hypothetical protein MIMGU_mgv1a0120571mg, partial [Mimulus guttatus] Length = 85 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/51 (66%), Positives = 40/51 (78%) Frame = +3 Query: 102 EPLLSPYSGQASGSTRGDSDIWSSRMREKYGLNNIGGDAK*NMLNPKASVD 254 EPL++PYS Q S S RGDSDIWSSRMR+KYGLN+ GDAK ++LN S D Sbjct: 35 EPLVAPYSSQTSPSIRGDSDIWSSRMRDKYGLNS--GDAKHSLLNQNQSND 83 >ref|XP_004495030.1| PREDICTED: tetraspanin-20-like [Cicer arietinum] Length = 251 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/39 (71%), Positives = 33/39 (84%), Gaps = 5/39 (12%) Frame = +3 Query: 102 EPLLSPYSGQASGSTRGD-----SDIWSSRMREKYGLNN 203 EPLL+P+SGQ SGS++GD SD+WSSRMREKYGLNN Sbjct: 205 EPLLNPHSGQTSGSSKGDIRGNHSDVWSSRMREKYGLNN 243