BLASTX nr result
ID: Mentha24_contig00018623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00018623 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006602978.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_003551785.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_006431232.1| hypothetical protein CICLE_v10011344mg [Citr... 67 2e-09 ref|XP_006482700.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 ref|XP_002526074.1| pentatricopeptide repeat-containing protein,... 65 7e-09 ref|XP_004169658.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_004141597.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_007214950.1| hypothetical protein PRUPE_ppa003127mg [Prun... 64 2e-08 ref|XP_007032674.1| Pentatricopeptide repeat superfamily protein... 64 2e-08 emb|CBI22283.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_002279015.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_004304183.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_006837037.1| hypothetical protein AMTR_s00110p00040270 [A... 59 5e-07 gb|EXB77627.1| hypothetical protein L484_018143 [Morus notabilis] 59 9e-07 ref|XP_003558514.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_002323888.2| hypothetical protein POPTR_0017s12620g [Popu... 55 8e-06 >ref|XP_006602978.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290-like isoform X2 [Glycine max] Length = 748 Score = 68.2 bits (165), Expect = 1e-09 Identities = 38/83 (45%), Positives = 51/83 (61%) Frame = +1 Query: 58 GSKNIMPPWGGVAGGETNDHRSSLDERSTITLEADGESIDEIEMYYLEERDEEVLSKRIL 237 G+K +PPWGGV E + H S +T + ++E + +LEE DE VLS RIL Sbjct: 269 GAKKELPPWGGV---EDDGHHDSRPVETTSSAPQGIGLLNEHGVLFLEELDENVLSNRIL 325 Query: 238 NLSRANKVRSALALYRSMDASGL 306 LSR NK+RSA+ +RSM+ SGL Sbjct: 326 VLSRTNKIRSAMEYFRSMELSGL 348 >ref|XP_003551785.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290-like isoform X1 [Glycine max] Length = 749 Score = 68.2 bits (165), Expect = 1e-09 Identities = 38/83 (45%), Positives = 51/83 (61%) Frame = +1 Query: 58 GSKNIMPPWGGVAGGETNDHRSSLDERSTITLEADGESIDEIEMYYLEERDEEVLSKRIL 237 G+K +PPWGGV E + H S +T + ++E + +LEE DE VLS RIL Sbjct: 269 GAKKELPPWGGV---EDDGHHDSRPVETTSSAPQGIGLLNEHGVLFLEELDENVLSNRIL 325 Query: 238 NLSRANKVRSALALYRSMDASGL 306 LSR NK+RSA+ +RSM+ SGL Sbjct: 326 VLSRTNKIRSAMEYFRSMELSGL 348 >ref|XP_006431232.1| hypothetical protein CICLE_v10011344mg [Citrus clementina] gi|557533289|gb|ESR44472.1| hypothetical protein CICLE_v10011344mg [Citrus clementina] Length = 591 Score = 67.4 bits (163), Expect = 2e-09 Identities = 43/101 (42%), Positives = 57/101 (56%), Gaps = 3/101 (2%) Frame = +1 Query: 13 ESVSVMEEEELTDESGSKNIMPPWGGVA---GGETNDHRSSLDERSTITLEADGESIDEI 183 E+ + EEL D + +PPWG V GG + +S + A G EI Sbjct: 94 ENHLIERREELLDLDFVGSNLPPWGNVVVQQGGSDVEVKSGNQPLAVSRKMAFGS---EI 150 Query: 184 EMYYLEERDEEVLSKRILNLSRANKVRSALALYRSMDASGL 306 + +LEE +EE+LS+R+L LSR+NKVRSAL LY SM SGL Sbjct: 151 RVQFLEEANEEILSRRVLMLSRSNKVRSALELYESMKCSGL 191 >ref|XP_006482700.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290-like [Citrus sinensis] Length = 592 Score = 65.5 bits (158), Expect = 7e-09 Identities = 42/101 (41%), Positives = 56/101 (55%), Gaps = 3/101 (2%) Frame = +1 Query: 13 ESVSVMEEEELTDESGSKNIMPPWGGVA---GGETNDHRSSLDERSTITLEADGESIDEI 183 E+ + EE D + +PPWG V GG + +S + A G EI Sbjct: 95 ENHLIERREEFLDLDFVGSNLPPWGNVVVQQGGSDVEVKSGNQPLAVSGKMAFGS---EI 151 Query: 184 EMYYLEERDEEVLSKRILNLSRANKVRSALALYRSMDASGL 306 + +LEE +EE+LS+R+L LSR+NKVRSAL LY SM SGL Sbjct: 152 RVQFLEEANEEILSRRVLMLSRSNKVRSALELYESMKCSGL 192 >ref|XP_002526074.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223534571|gb|EEF36268.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 285 Score = 65.5 bits (158), Expect = 7e-09 Identities = 40/105 (38%), Positives = 60/105 (57%), Gaps = 6/105 (5%) Frame = +1 Query: 10 DESVSVMEEEELTDESGSKNIMPPWGGVAGGETNDH------RSSLDERSTITLEADGES 171 +E + ++ D + +PPWG + + + + S+ R+TI S Sbjct: 24 EEQEVIQSRKDELDMDSFEKYLPPWGNLTVHQEPELDPAGIVQPSISPRNTI-------S 76 Query: 172 IDEIEMYYLEERDEEVLSKRILNLSRANKVRSALALYRSMDASGL 306 +DE ++ LEE +EE LS+RIL LSR+NKVRSAL L+RSM+ SGL Sbjct: 77 LDESRVHLLEEGNEEELSRRILMLSRSNKVRSALELFRSMEFSGL 121 >ref|XP_004169658.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290-like [Cucumis sativus] Length = 600 Score = 64.7 bits (156), Expect = 1e-08 Identities = 41/101 (40%), Positives = 65/101 (64%), Gaps = 1/101 (0%) Frame = +1 Query: 10 DESVSVMEEEELTDESGSKNIMPPWGGVAGGETNDHRSSLDERSTITLEADGESID-EIE 186 DE++ ++ +E + +ES + +PPWG +A + +S + I +G+ ++ E + Sbjct: 85 DEAIELVIDEGV-EESSREWKLPPWGDIAHQDEATFQSEDVNQPKIL---EGKVLENESK 140 Query: 187 MYYLEERDEEVLSKRILNLSRANKVRSALALYRSMDASGLL 309 +++LEE D+ +LSKRIL LSR NKVRSAL L RSM +GLL Sbjct: 141 LHFLEETDKVMLSKRILILSRKNKVRSALELLRSMQLAGLL 181 >ref|XP_004141597.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290-like [Cucumis sativus] Length = 600 Score = 64.7 bits (156), Expect = 1e-08 Identities = 41/101 (40%), Positives = 65/101 (64%), Gaps = 1/101 (0%) Frame = +1 Query: 10 DESVSVMEEEELTDESGSKNIMPPWGGVAGGETNDHRSSLDERSTITLEADGESID-EIE 186 DE++ ++ +E + +ES + +PPWG +A + +S + I +G+ ++ E + Sbjct: 85 DEAIELVIDEGV-EESSREWKLPPWGDIAHQDEATFQSEDVNQPKIL---EGKVLENESK 140 Query: 187 MYYLEERDEEVLSKRILNLSRANKVRSALALYRSMDASGLL 309 +++LEE D+ +LSKRIL LSR NKVRSAL L RSM +GLL Sbjct: 141 LHFLEETDKVMLSKRILILSRKNKVRSALELLRSMQLAGLL 181 >ref|XP_007214950.1| hypothetical protein PRUPE_ppa003127mg [Prunus persica] gi|462411100|gb|EMJ16149.1| hypothetical protein PRUPE_ppa003127mg [Prunus persica] Length = 601 Score = 64.3 bits (155), Expect = 2e-08 Identities = 41/100 (41%), Positives = 56/100 (56%) Frame = +1 Query: 10 DESVSVMEEEELTDESGSKNIMPPWGGVAGGETNDHRSSLDERSTITLEADGESIDEIEM 189 +E V++ E + S K +PPWG +A E D + + L+ S++ + Sbjct: 85 EEEDKVVQREGGYEASFVKQTLPPWGELAIDEDLDFEPEVPIQPESCLKRKA-SLNVNRV 143 Query: 190 YYLEERDEEVLSKRILNLSRANKVRSALALYRSMDASGLL 309 +LEE DE LSKRIL LSR NK RSAL L+ SM+ SGLL Sbjct: 144 SFLEEMDEGTLSKRILVLSRTNKTRSALELFTSMELSGLL 183 >ref|XP_007032674.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|590650578|ref|XP_007032675.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508711703|gb|EOY03600.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508711704|gb|EOY03601.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 619 Score = 63.9 bits (154), Expect = 2e-08 Identities = 39/100 (39%), Positives = 64/100 (64%), Gaps = 1/100 (1%) Frame = +1 Query: 10 DESVSVME-EEELTDESGSKNIMPPWGGVAGGETNDHRSSLDERSTITLEADGESIDEIE 186 +E++ + + +EE +S +N+ PPWG + E+ D + + I+ +S+ + + Sbjct: 111 EENILIQKGKEEFGLDSLGQNL-PPWGNLVVDESLDFEHTSVGQPAISSNGK-DSVHDSK 168 Query: 187 MYYLEERDEEVLSKRILNLSRANKVRSALALYRSMDASGL 306 +++LEE +EE LS+R+L LSR+NKVRSAL L RSM SGL Sbjct: 169 VHFLEETNEEELSRRVLMLSRSNKVRSALELCRSMKLSGL 208 >emb|CBI22283.3| unnamed protein product [Vitis vinifera] Length = 626 Score = 61.2 bits (147), Expect = 1e-07 Identities = 38/99 (38%), Positives = 57/99 (57%) Frame = +1 Query: 10 DESVSVMEEEELTDESGSKNIMPPWGGVAGGETNDHRSSLDERSTITLEADGESIDEIEM 189 +E++ +E D S + PP G + D + +T+ S E ++ Sbjct: 115 EENMLNQRRKEEFDPSYFEQKFPPLGNSEIHKNPDFEH-IGVAEPLTISTGISSEFEDKL 173 Query: 190 YYLEERDEEVLSKRILNLSRANKVRSALALYRSMDASGL 306 ++LEER+E++LSKRIL LSR+NKVRS L LYR+M+ SGL Sbjct: 174 HFLEERNEQILSKRILMLSRSNKVRSVLELYRTMEFSGL 212 >ref|XP_002279015.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290-like [Vitis vinifera] Length = 546 Score = 61.2 bits (147), Expect = 1e-07 Identities = 38/99 (38%), Positives = 57/99 (57%) Frame = +1 Query: 10 DESVSVMEEEELTDESGSKNIMPPWGGVAGGETNDHRSSLDERSTITLEADGESIDEIEM 189 +E++ +E D S + PP G + D + +T+ S E ++ Sbjct: 35 EENMLNQRRKEEFDPSYFEQKFPPLGNSEIHKNPDFEH-IGVAEPLTISTGISSEFEDKL 93 Query: 190 YYLEERDEEVLSKRILNLSRANKVRSALALYRSMDASGL 306 ++LEER+E++LSKRIL LSR+NKVRS L LYR+M+ SGL Sbjct: 94 HFLEERNEQILSKRILMLSRSNKVRSVLELYRTMEFSGL 132 >ref|XP_004304183.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290-like [Fragaria vesca subsp. vesca] Length = 588 Score = 59.7 bits (143), Expect = 4e-07 Identities = 44/107 (41%), Positives = 60/107 (56%), Gaps = 8/107 (7%) Frame = +1 Query: 13 ESVSVMEEEELTDESGSK-----NIMPPWGGVAGGETNDHRSSLDE---RSTITLEADGE 168 +S V E +E D+ G K ++PPWG +A + H E R ++L E Sbjct: 65 QSGLVCERQE--DKQGYKACLVEQVLPPWGDLAIDKDPVHPDIEPEVAIRPELSLNRK-E 121 Query: 169 SIDEIEMYYLEERDEEVLSKRILNLSRANKVRSALALYRSMDASGLL 309 ++ + +LEE DEE LSKRIL LSR NK RSAL L+ SM+ SGL+ Sbjct: 122 VLNVDRVSFLEEVDEETLSKRILVLSRTNKFRSALELFTSMELSGLV 168 >ref|XP_006837037.1| hypothetical protein AMTR_s00110p00040270 [Amborella trichopoda] gi|548839630|gb|ERM99890.1| hypothetical protein AMTR_s00110p00040270 [Amborella trichopoda] Length = 622 Score = 59.3 bits (142), Expect = 5e-07 Identities = 38/95 (40%), Positives = 53/95 (55%), Gaps = 13/95 (13%) Frame = +1 Query: 61 SKNIMPPWG------------GVAGGETNDHRSSLDERSTITLEADGE-SIDEIEMYYLE 201 SK +PPWG G +D + + S T +D + +E++M++LE Sbjct: 103 SKAKIPPWGVKFITEDKNVDSTSVFGSNHDSKRPHPDMSKPTSSSDSKVQQNELKMHFLE 162 Query: 202 ERDEEVLSKRILNLSRANKVRSALALYRSMDASGL 306 E +EE LSKRIL LSR+NK+ SAL LY SM+ S L Sbjct: 163 ETNEESLSKRILVLSRSNKINSALELYMSMEMSSL 197 >gb|EXB77627.1| hypothetical protein L484_018143 [Morus notabilis] Length = 550 Score = 58.5 bits (140), Expect = 9e-07 Identities = 42/116 (36%), Positives = 57/116 (49%), Gaps = 14/116 (12%) Frame = +1 Query: 1 ASLDESVSVMEEEELTDESGS-------------KNIMPPWGGVAGGETNDHR-SSLDER 138 A ++ E EE DESG + I+PPW + + D L+ Sbjct: 12 AKIEYGFLCREGEEDKDESGQLEKVGFELEAPVIEQILPPWRNLETSKDLDFEPDGLNPP 71 Query: 139 STITLEADGESIDEIEMYYLEERDEEVLSKRILNLSRANKVRSALALYRSMDASGL 306 + E +++ +++LEE DE LS RIL LSR NKVRSAL L RSM+ SGL Sbjct: 72 KVVPREKAVLNLNVNSVHFLEEVDEAKLSNRILVLSRTNKVRSALELLRSMELSGL 127 >ref|XP_003558514.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290-like isoform 1 [Brachypodium distachyon] gi|357113449|ref|XP_003558515.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290-like isoform 2 [Brachypodium distachyon] gi|357113451|ref|XP_003558516.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290-like isoform 3 [Brachypodium distachyon] Length = 574 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/40 (65%), Positives = 36/40 (90%) Frame = +1 Query: 187 MYYLEERDEEVLSKRILNLSRANKVRSALALYRSMDASGL 306 +++LEERDEE+LS+R++NLS++NKVRSA L+ SM ASGL Sbjct: 134 LHFLEERDEEILSRRLINLSKSNKVRSATELFDSMRASGL 173 >ref|XP_002323888.2| hypothetical protein POPTR_0017s12620g [Populus trichocarpa] gi|550320141|gb|EEF04021.2| hypothetical protein POPTR_0017s12620g [Populus trichocarpa] Length = 716 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = +1 Query: 169 SIDEIEMYYLEERDEEVLSKRILNLSRANKVRSALALYRSMDASGL 306 +++E +++LEE DE LS+RIL LSR+NK+RSAL L RSM+ SGL Sbjct: 262 TVNESRVHFLEETDENELSRRILMLSRSNKIRSALQLLRSMEFSGL 307