BLASTX nr result
ID: Mentha24_contig00018538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00018538 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39650.1| hypothetical protein MIMGU_mgv1a012648mg [Mimulus... 55 1e-05 >gb|EYU39650.1| hypothetical protein MIMGU_mgv1a012648mg [Mimulus guttatus] Length = 244 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = -2 Query: 400 QDSC-LVSPTTSGGGFSNKRGMLSREKASDFDFSPTSKYQKVCSPI 266 QDSC LVSP+ GGF+NKR M++ +K D DFSP SK+QKVCSPI Sbjct: 203 QDSCRLVSPS---GGFTNKRAMVNMDK--DLDFSPISKFQKVCSPI 243