BLASTX nr result
ID: Mentha24_contig00018432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00018432 (527 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19793.1| hypothetical protein MIMGU_mgv1a005002mg [Mimulus... 55 8e-06 >gb|EYU19793.1| hypothetical protein MIMGU_mgv1a005002mg [Mimulus guttatus] Length = 501 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/51 (62%), Positives = 38/51 (74%), Gaps = 3/51 (5%) Frame = -3 Query: 525 VGSNLEL---GFSKKGASFRFYHVKTASQLHLNDIPHLLAEYKEFLSSTNI 382 +G LEL GF K A FRF HVK+ASQL +++IP+LLAEYKE LSST I Sbjct: 448 LGCKLELADSGFRGKDA-FRFCHVKSASQLRMSEIPNLLAEYKELLSSTGI 497