BLASTX nr result
ID: Mentha24_contig00018321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00018321 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25198.1| hypothetical protein MIMGU_mgv1a004656mg [Mimulus... 60 3e-07 gb|EPS69584.1| hypothetical protein M569_05182, partial [Genlise... 60 3e-07 ref|XP_002513587.1| RNA polymerase sigma factor rpoD, putative [... 59 5e-07 gb|EYU19623.1| hypothetical protein MIMGU_mgv1a020453mg [Mimulus... 58 1e-06 ref|XP_002268709.1| PREDICTED: RNA polymerase sigma factor rpoD ... 58 1e-06 ref|XP_006847349.1| hypothetical protein AMTR_s00015p00252960 [A... 58 2e-06 ref|XP_004308009.1| PREDICTED: RNA polymerase sigma factor sigE,... 58 2e-06 ref|XP_006350582.1| PREDICTED: RNA polymerase sigma factor sigE,... 57 2e-06 ref|XP_007038959.1| Sigma factor E isoform 1 [Theobroma cacao] g... 57 2e-06 ref|XP_007219010.1| hypothetical protein PRUPE_ppa004259mg [Prun... 57 2e-06 ref|XP_004234180.1| PREDICTED: RNA polymerase sigma factor sigE,... 57 2e-06 ref|XP_004234179.1| PREDICTED: RNA polymerase sigma factor sigE,... 57 2e-06 gb|EXB72455.1| RNA polymerase sigma factor rpoD [Morus notabilis] 57 3e-06 ref|XP_004166500.1| PREDICTED: RNA polymerase sigma factor sigE,... 57 3e-06 ref|XP_004149458.1| PREDICTED: RNA polymerase sigma factor sigE,... 57 3e-06 ref|XP_007161346.1| hypothetical protein PHAVU_001G061400g [Phas... 56 5e-06 ref|NP_001254001.1| RNA polymerase sigma factor rpoD-like [Glyci... 56 5e-06 ref|XP_006376620.1| RNA polymerase sigma subunit SigE family pro... 56 6e-06 >gb|EYU25198.1| hypothetical protein MIMGU_mgv1a004656mg [Mimulus guttatus] Length = 516 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLRHRI 95 NISREMVRK+EVKA MKLKHPARVDYLRH I Sbjct: 484 NISREMVRKHEVKAFMKLKHPARVDYLRHHI 514 >gb|EPS69584.1| hypothetical protein M569_05182, partial [Genlisea aurea] Length = 488 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLRHRIF 98 NISREMVRK+EVKALMKLKHPARVDYLR IF Sbjct: 456 NISREMVRKHEVKALMKLKHPARVDYLRRYIF 487 >ref|XP_002513587.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis] gi|223547495|gb|EEF48990.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis] Length = 501 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLRHRI 95 NISREMVRKYEVKALMKLKHPARVDYLR + Sbjct: 470 NISREMVRKYEVKALMKLKHPARVDYLRRYV 500 >gb|EYU19623.1| hypothetical protein MIMGU_mgv1a020453mg [Mimulus guttatus] Length = 515 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLRHRIF 98 NISREMVRKYEVKALMKLKH ARVDYLR +F Sbjct: 483 NISREMVRKYEVKALMKLKHRARVDYLRRYVF 514 >ref|XP_002268709.1| PREDICTED: RNA polymerase sigma factor rpoD [Vitis vinifera] gi|302143685|emb|CBI22546.3| unnamed protein product [Vitis vinifera] Length = 518 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLRHRIF 98 +ISREMVRK+EVKALMKLKHPARVDYLR IF Sbjct: 487 SISREMVRKHEVKALMKLKHPARVDYLRQYIF 518 >ref|XP_006847349.1| hypothetical protein AMTR_s00015p00252960 [Amborella trichopoda] gi|548850426|gb|ERN08930.1| hypothetical protein AMTR_s00015p00252960 [Amborella trichopoda] Length = 128 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLRHRI 95 NISREMVRK+EVKALMKLKHPARVDYLR I Sbjct: 97 NISREMVRKHEVKALMKLKHPARVDYLRRYI 127 >ref|XP_004308009.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like [Fragaria vesca subsp. vesca] Length = 520 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLRHRI 95 NISREMVRK+EVKALMKLKHPARVDYLR I Sbjct: 489 NISREMVRKHEVKALMKLKHPARVDYLRRYI 519 >ref|XP_006350582.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like [Solanum tuberosum] Length = 516 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLRHRIF 98 NISREMVRK+EVKALMKLKHP RVDY+R IF Sbjct: 485 NISREMVRKHEVKALMKLKHPTRVDYVRRYIF 516 >ref|XP_007038959.1| Sigma factor E isoform 1 [Theobroma cacao] gi|590673674|ref|XP_007038960.1| Sigma factor E isoform 1 [Theobroma cacao] gi|508776204|gb|EOY23460.1| Sigma factor E isoform 1 [Theobroma cacao] gi|508776205|gb|EOY23461.1| Sigma factor E isoform 1 [Theobroma cacao] Length = 516 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLRHRI 95 NISREMVRK+EVKALMKLKHPARVDYLR + Sbjct: 485 NISREMVRKHEVKALMKLKHPARVDYLRRYV 515 >ref|XP_007219010.1| hypothetical protein PRUPE_ppa004259mg [Prunus persica] gi|462415472|gb|EMJ20209.1| hypothetical protein PRUPE_ppa004259mg [Prunus persica] Length = 519 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLRHRI 95 NISREMVRK+EVKALMKLKHPARVDYLR + Sbjct: 488 NISREMVRKHEVKALMKLKHPARVDYLRRYV 518 >ref|XP_004234180.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like isoform 2 [Solanum lycopersicum] Length = 487 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLRHRIF 98 NISREMVRK+EVKALMKLKHP RVDY+R IF Sbjct: 456 NISREMVRKHEVKALMKLKHPTRVDYVRRYIF 487 >ref|XP_004234179.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like isoform 1 [Solanum lycopersicum] Length = 516 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLRHRIF 98 NISREMVRK+EVKALMKLKHP RVDY+R IF Sbjct: 485 NISREMVRKHEVKALMKLKHPTRVDYVRRYIF 516 >gb|EXB72455.1| RNA polymerase sigma factor rpoD [Morus notabilis] Length = 517 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLR 86 NISREMVRK+EVKALMKLKHPARVDYLR Sbjct: 486 NISREMVRKHEVKALMKLKHPARVDYLR 513 >ref|XP_004166500.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like [Cucumis sativus] Length = 515 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLR 86 NISREMVRK+EVKALMKLKHPARVDYLR Sbjct: 484 NISREMVRKHEVKALMKLKHPARVDYLR 511 >ref|XP_004149458.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like [Cucumis sativus] Length = 514 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLR 86 NISREMVRK+EVKALMKLKHPARVDYLR Sbjct: 483 NISREMVRKHEVKALMKLKHPARVDYLR 510 >ref|XP_007161346.1| hypothetical protein PHAVU_001G061400g [Phaseolus vulgaris] gi|561034810|gb|ESW33340.1| hypothetical protein PHAVU_001G061400g [Phaseolus vulgaris] Length = 511 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLRHRI 95 NISREMVRK+EVKALMKLKHPAR+DYLR + Sbjct: 480 NISREMVRKHEVKALMKLKHPARLDYLRRYV 510 >ref|NP_001254001.1| RNA polymerase sigma factor rpoD-like [Glycine max] gi|382365028|dbj|BAM05477.1| sigma-like factor 5A [Glycine max] Length = 512 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLRHRI 95 NISREMVRK+EVKALMKLKHPAR+DYLR + Sbjct: 481 NISREMVRKHEVKALMKLKHPARLDYLRRYV 511 >ref|XP_006376620.1| RNA polymerase sigma subunit SigE family protein [Populus trichocarpa] gi|550326141|gb|ERP54417.1| RNA polymerase sigma subunit SigE family protein [Populus trichocarpa] Length = 512 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 NISREMVRKYEVKALMKLKHPARVDYLRHRI 95 NISREMVRK+EVKALMKLKHP RVDYLR + Sbjct: 481 NISREMVRKHEVKALMKLKHPTRVDYLRRYV 511