BLASTX nr result
ID: Mentha24_contig00018297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00018297 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006483487.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 >ref|XP_006483487.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Citrus sinensis] Length = 1107 Score = 58.2 bits (139), Expect = 1e-06 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 15/105 (14%) Frame = -1 Query: 270 DSSRLCAP--SYSGASSNRRKH------DSFGVLRYGSANY-WKKIKKKNGSFCGYVMKC 118 DSS C SYS A + + H S G L+ G+ WKK KK FCGYVMK Sbjct: 7 DSSSTCCSTISYSFAFTYSKLHASSYNNGSVGGLKVGNLKVNWKKHWKKQVGFCGYVMKS 66 Query: 117 SDAVSL------NDMSSEEIMARLKSIGELDLAFLFFTSIVDLPH 1 S+ V + N ++SEE++ L+S +LD + +F S+ +LP+ Sbjct: 67 SNEVVVVKGKPRNGLTSEEVIRVLRSFSDLDSTYSYFKSVAELPY 111