BLASTX nr result
ID: Mentha24_contig00018052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00018052 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33407.1| hypothetical protein MIMGU_mgv1a012254mg [Mimulus... 76 4e-12 >gb|EYU33407.1| hypothetical protein MIMGU_mgv1a012254mg [Mimulus guttatus] Length = 256 Score = 76.3 bits (186), Expect = 4e-12 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 2/89 (2%) Frame = -1 Query: 296 MAALAQISINFSALPTYSNSCKKLGSYNLNFLQPLNYCSSSRIRIQSFHKDSFKADASRE 117 M AL +SINFS+ + CK S+ QP NY ++I+SF K FK+DA + Sbjct: 1 MPALLHVSINFSSALHPPHRCKCNTSFKFELPQPSNYYPHPTLKIESFRKGRFKSDALGD 60 Query: 116 KLPFLGVSRGKDGFLVSKGR--RVVLAKF 36 LP LGV RGKDG LVSKGR R V KF Sbjct: 61 NLPLLGVGRGKDGILVSKGRRKRAVAVKF 89