BLASTX nr result
ID: Mentha24_contig00018019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00018019 (402 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21398.1| hypothetical protein MIMGU_mgv1a000462mg [Mimulus... 72 1e-10 >gb|EYU21398.1| hypothetical protein MIMGU_mgv1a000462mg [Mimulus guttatus] Length = 1135 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/67 (53%), Positives = 46/67 (68%), Gaps = 3/67 (4%) Frame = +2 Query: 209 EEVDIMAGDDEKESKLKFQDPDPTAPTNPVSWSNFDNESVD---NQDHISDLIEIDIEND 379 E+VDIM DD+KESK K ++ +P +PV WS+ DNESVD DH+S ++E IE D Sbjct: 464 EDVDIMTSDDDKESKHKLRNSEPVTSKSPVQWSHPDNESVDIGNYDDHVSGVVE--IEKD 521 Query: 380 SPEHDHG 400 SPE DHG Sbjct: 522 SPEDDHG 528