BLASTX nr result
ID: Mentha24_contig00017487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00017487 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007047478.1| Phototropic-responsive NPH3 family protein [... 59 5e-07 >ref|XP_007047478.1| Phototropic-responsive NPH3 family protein [Theobroma cacao] gi|508699739|gb|EOX91635.1| Phototropic-responsive NPH3 family protein [Theobroma cacao] Length = 623 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +3 Query: 192 MLDLDGEQTTPSDSANMSTKKKDLLSTAMKRTSEWIFS 305 M+DLD E+T PS S NMS+KKK+LLSTAMKRTSEWIFS Sbjct: 1 MVDLDQEETAPS-SLNMSSKKKELLSTAMKRTSEWIFS 37