BLASTX nr result
ID: Mentha24_contig00017213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00017213 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34971.1| hypothetical protein MIMGU_mgv1a007382mg [Mimulus... 57 2e-06 ref|XP_003526449.1| PREDICTED: uncharacterized protein At2g24330... 55 8e-06 >gb|EYU34971.1| hypothetical protein MIMGU_mgv1a007382mg [Mimulus guttatus] Length = 409 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -1 Query: 160 MADDSRNDVKESTKSTDAEMXXXXXXK-GLLSRVWGAIFRLHGDDFEKRLKYIS 2 MA +S+ND ES S D E+ K G+LSR+W A+FR+ GDDFEKRL+YIS Sbjct: 1 MAGESKNDAVESVTSKDPEIKKTQKKKKGVLSRLWSALFRVKGDDFEKRLQYIS 54 >ref|XP_003526449.1| PREDICTED: uncharacterized protein At2g24330 [Glycine max] Length = 408 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/57 (50%), Positives = 35/57 (61%), Gaps = 4/57 (7%) Frame = -1 Query: 160 MADDSR----NDVKESTKSTDAEMXXXXXXKGLLSRVWGAIFRLHGDDFEKRLKYIS 2 MADD + ++KE+T T KG L R+W IFRLHGDDFEKRL+YIS Sbjct: 1 MADDDKAVGEGEMKETTGGTSPSGSGKKKNKGFLLRIWNGIFRLHGDDFEKRLQYIS 57