BLASTX nr result
ID: Mentha24_contig00017145
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00017145 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29081.1| hypothetical protein MIMGU_mgv1a004898mg [Mimulus... 68 2e-09 ref|XP_004307171.1| PREDICTED: UDP-glycosyltransferase 73C5-like... 58 2e-06 >gb|EYU29081.1| hypothetical protein MIMGU_mgv1a004898mg [Mimulus guttatus] Length = 505 Score = 67.8 bits (164), Expect = 2e-09 Identities = 36/61 (59%), Positives = 42/61 (68%) Frame = -1 Query: 378 VAKYLNVGIKVLSSDEESGTVKKSDISRGIEGLMGDGEIRGRAMALRGVFKDGYPSTSAA 199 V KYL VG V S + VKK DI GI+ LM DGE+ GRAMALRG+F+ GYPS+S A Sbjct: 435 VVKYLKVGHMVSSGGGLAEMVKKCDIMEGIKVLMDDGEVHGRAMALRGIFEAGYPSSSDA 494 Query: 198 S 196 S Sbjct: 495 S 495 >ref|XP_004307171.1| PREDICTED: UDP-glycosyltransferase 73C5-like [Fragaria vesca subsp. vesca] Length = 476 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/61 (49%), Positives = 44/61 (72%) Frame = -1 Query: 378 VAKYLNVGIKVLSSDEESGTVKKSDISRGIEGLMGDGEIRGRAMALRGVFKDGYPSTSAA 199 V YL VG +V +++ S V+K DI RGIE LMGD E++ RA+A+R F+DG+P++S A Sbjct: 404 VVNYLKVGYRV--AEDLSEMVRKEDIVRGIERLMGDEEMKKRAVAIREKFEDGFPASSKA 461 Query: 198 S 196 + Sbjct: 462 A 462