BLASTX nr result
ID: Mentha24_contig00017119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00017119 (371 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41987.1| hypothetical protein MIMGU_mgv1a000241mg [Mimulus... 72 6e-11 ref|XP_004249708.1| PREDICTED: regulatory-associated protein of ... 69 7e-10 ref|XP_006366877.1| PREDICTED: regulatory-associated protein of ... 67 2e-09 ref|XP_007033600.1| HEAT repeat,WD domain, G-beta repeat protein... 67 2e-09 ref|XP_004246316.1| PREDICTED: regulatory-associated protein of ... 67 2e-09 ref|XP_004149929.1| PREDICTED: regulatory-associated protein of ... 67 3e-09 ref|XP_006602695.1| PREDICTED: regulatory-associated protein of ... 63 4e-08 ref|XP_006602694.1| PREDICTED: regulatory-associated protein of ... 63 4e-08 ref|XP_006602693.1| PREDICTED: regulatory-associated protein of ... 63 4e-08 ref|XP_006602692.1| PREDICTED: regulatory-associated protein of ... 63 4e-08 ref|XP_007140148.1| hypothetical protein PHAVU_008G087800g [Phas... 63 4e-08 ref|XP_003632588.1| PREDICTED: regulatory-associated protein of ... 63 4e-08 ref|XP_003551595.1| PREDICTED: regulatory-associated protein of ... 63 4e-08 ref|XP_003533671.1| PREDICTED: regulatory-associated protein of ... 63 4e-08 ref|XP_003632587.1| PREDICTED: regulatory-associated protein of ... 63 4e-08 ref|XP_003623550.1| Regulatory-associated protein of mTOR [Medic... 62 6e-08 ref|XP_004492529.1| PREDICTED: regulatory-associated protein of ... 62 8e-08 ref|XP_004492528.1| PREDICTED: regulatory-associated protein of ... 62 8e-08 ref|XP_007208391.1| hypothetical protein PRUPE_ppa000282mg [Prun... 62 1e-07 ref|XP_002533827.1| Regulatory-associated protein of mTOR, putat... 62 1e-07 >gb|EYU41987.1| hypothetical protein MIMGU_mgv1a000241mg [Mimulus guttatus] Length = 1375 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADEISLPR 259 KIGSVSCLTFHPYQVLLAAGAADACVSIYADEI PR Sbjct: 1339 KIGSVSCLTFHPYQVLLAAGAADACVSIYADEILPPR 1375 >ref|XP_004249708.1| PREDICTED: regulatory-associated protein of TOR 1-like [Solanum lycopersicum] Length = 1192 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 366 IGSVSCLTFHPYQVLLAAGAADACVSIYADEISLP 262 IGSV CLTFHPYQVLLAAGAADACVSIYADEIS P Sbjct: 1157 IGSVRCLTFHPYQVLLAAGAADACVSIYADEISPP 1191 >ref|XP_006366877.1| PREDICTED: regulatory-associated protein of TOR 1-like [Solanum tuberosum] Length = 1353 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADEISLPR 259 KIGSV CLTFHPYQVLLAAGAAD+CVSIYADEI+ R Sbjct: 1317 KIGSVRCLTFHPYQVLLAAGAADSCVSIYADEIAPTR 1353 >ref|XP_007033600.1| HEAT repeat,WD domain, G-beta repeat protein isoform 2 [Theobroma cacao] gi|508712629|gb|EOY04526.1| HEAT repeat,WD domain, G-beta repeat protein isoform 2 [Theobroma cacao] Length = 1362 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADEISLPR 259 KIGSVSCLTFHPYQV LAAGA DACVSIYAD+ S PR Sbjct: 1326 KIGSVSCLTFHPYQVRLAAGATDACVSIYADDNSQPR 1362 >ref|XP_004246316.1| PREDICTED: regulatory-associated protein of TOR 1-like [Solanum lycopersicum] Length = 1353 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADEISLPR 259 KIGSV CLTFHPYQVLLAAGAAD+CVSIYADEI+ R Sbjct: 1317 KIGSVRCLTFHPYQVLLAAGAADSCVSIYADEITPTR 1353 >ref|XP_004149929.1| PREDICTED: regulatory-associated protein of TOR 1-like [Cucumis sativus] gi|449517611|ref|XP_004165839.1| PREDICTED: regulatory-associated protein of TOR 1-like [Cucumis sativus] Length = 1362 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADEISLPR 259 KIGSVSCLTFHPY+VLLAAGAADACVSIYAD+ S R Sbjct: 1326 KIGSVSCLTFHPYEVLLAAGAADACVSIYADDNSQGR 1362 >ref|XP_006602695.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X5 [Glycine max] Length = 1105 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADE 274 KIGSVSCL FHPYQVLLAAGAADACV IYAD+ Sbjct: 1069 KIGSVSCLNFHPYQVLLAAGAADACVCIYADD 1100 >ref|XP_006602694.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X4 [Glycine max] Length = 1146 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADE 274 KIGSVSCL FHPYQVLLAAGAADACV IYAD+ Sbjct: 1110 KIGSVSCLNFHPYQVLLAAGAADACVCIYADD 1141 >ref|XP_006602693.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X3 [Glycine max] Length = 1258 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADE 274 KIGSVSCL FHPYQVLLAAGAADACV IYAD+ Sbjct: 1222 KIGSVSCLNFHPYQVLLAAGAADACVCIYADD 1253 >ref|XP_006602692.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X2 [Glycine max] Length = 1312 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADE 274 KIGSVSCL FHPYQVLLAAGAADACV IYAD+ Sbjct: 1276 KIGSVSCLNFHPYQVLLAAGAADACVCIYADD 1307 >ref|XP_007140148.1| hypothetical protein PHAVU_008G087800g [Phaseolus vulgaris] gi|561013281|gb|ESW12142.1| hypothetical protein PHAVU_008G087800g [Phaseolus vulgaris] Length = 1370 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADE 274 KIGSVSCL FHPYQVLLAAGAADACV IYAD+ Sbjct: 1334 KIGSVSCLNFHPYQVLLAAGAADACVCIYADD 1365 >ref|XP_003632588.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform 2 [Vitis vinifera] Length = 1370 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADEISLPR 259 KIGSV+CLTFHPYQVLLAAGAADA VSIYAD+ S R Sbjct: 1334 KIGSVNCLTFHPYQVLLAAGAADALVSIYADDNSQAR 1370 >ref|XP_003551595.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X1 [Glycine max] Length = 1365 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADE 274 KIGSVSCL FHPYQVLLAAGAADACV IYAD+ Sbjct: 1329 KIGSVSCLNFHPYQVLLAAGAADACVCIYADD 1360 >ref|XP_003533671.1| PREDICTED: regulatory-associated protein of TOR 1-like [Glycine max] Length = 1373 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADE 274 KIGSVSCL FHPYQVLLAAGAADACV IYAD+ Sbjct: 1337 KIGSVSCLNFHPYQVLLAAGAADACVCIYADD 1368 >ref|XP_003632587.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform 1 [Vitis vinifera] gi|297735579|emb|CBI18073.3| unnamed protein product [Vitis vinifera] Length = 1363 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADEISLPR 259 KIGSV+CLTFHPYQVLLAAGAADA VSIYAD+ S R Sbjct: 1327 KIGSVNCLTFHPYQVLLAAGAADALVSIYADDNSQAR 1363 >ref|XP_003623550.1| Regulatory-associated protein of mTOR [Medicago truncatula] gi|355498565|gb|AES79768.1| Regulatory-associated protein of mTOR [Medicago truncatula] Length = 1430 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADE 274 KIGSVSCL+FHPYQ+LLAAGAADACV IYAD+ Sbjct: 1394 KIGSVSCLSFHPYQLLLAAGAADACVCIYADD 1425 >ref|XP_004492529.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X2 [Cicer arietinum] Length = 1149 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADE 274 KIGSVSCL FHPYQ+LLAAGAADACV IYAD+ Sbjct: 1113 KIGSVSCLNFHPYQLLLAAGAADACVCIYADD 1144 >ref|XP_004492528.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X1 [Cicer arietinum] Length = 1369 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADE 274 KIGSVSCL FHPYQ+LLAAGAADACV IYAD+ Sbjct: 1333 KIGSVSCLNFHPYQLLLAAGAADACVCIYADD 1364 >ref|XP_007208391.1| hypothetical protein PRUPE_ppa000282mg [Prunus persica] gi|462404033|gb|EMJ09590.1| hypothetical protein PRUPE_ppa000282mg [Prunus persica] Length = 1346 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADEISLPR 259 KIG VSCL FHPY+VLLAAGAADAC SIYAD+ S R Sbjct: 1310 KIGPVSCLAFHPYEVLLAAGAADACASIYADDNSQAR 1346 >ref|XP_002533827.1| Regulatory-associated protein of mTOR, putative [Ricinus communis] gi|223526244|gb|EEF28562.1| Regulatory-associated protein of mTOR, putative [Ricinus communis] Length = 1221 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = -3 Query: 369 KIGSVSCLTFHPYQVLLAAGAADACVSIYADEISLPR 259 KIG VSCLTFHPYQVLLAAGAADA VSIY DE S R Sbjct: 1185 KIGPVSCLTFHPYQVLLAAGAADAWVSIYTDENSQAR 1221