BLASTX nr result
ID: Mentha24_contig00017082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00017082 (440 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31230.1| hypothetical protein MIMGU_mgv1a018326mg, partial... 84 2e-14 gb|EPS70900.1| hypothetical protein M569_03859, partial [Genlise... 74 3e-11 ref|XP_006345747.1| PREDICTED: ultraviolet-B receptor UVR8-like ... 69 9e-10 ref|XP_006345746.1| PREDICTED: ultraviolet-B receptor UVR8-like ... 69 9e-10 ref|XP_006345745.1| PREDICTED: ultraviolet-B receptor UVR8-like ... 69 9e-10 ref|XP_004239624.1| PREDICTED: E3 ubiquitin-protein ligase HERC2... 68 1e-09 ref|XP_004161671.1| PREDICTED: probable E3 ubiquitin-protein lig... 67 3e-09 ref|XP_004144697.1| PREDICTED: probable E3 ubiquitin-protein lig... 67 3e-09 ref|XP_007048577.1| Regulator of chromosome condensation (RCC1) ... 66 4e-09 ref|XP_007048576.1| Regulator of chromosome condensation (RCC1) ... 66 4e-09 ref|XP_006491926.1| PREDICTED: probable E3 ubiquitin-protein lig... 66 6e-09 ref|XP_006491925.1| PREDICTED: probable E3 ubiquitin-protein lig... 66 6e-09 ref|XP_006491924.1| PREDICTED: probable E3 ubiquitin-protein lig... 66 6e-09 ref|XP_006491923.1| PREDICTED: probable E3 ubiquitin-protein lig... 66 6e-09 ref|XP_006491915.1| PREDICTED: probable E3 ubiquitin-protein lig... 66 6e-09 ref|XP_002273073.1| PREDICTED: E3 ubiquitin-protein ligase HERC2... 65 8e-09 ref|XP_006856653.1| hypothetical protein AMTR_s00054p00031170 [A... 65 1e-08 dbj|BAJ84921.1| predicted protein [Hordeum vulgare subsp. vulgare] 64 2e-08 ref|NP_680156.2| regulator of chromosome condensation repeat-con... 64 3e-08 ref|XP_003602697.1| X-linked retinitis pigmentosa GTPase regulat... 64 3e-08 >gb|EYU31230.1| hypothetical protein MIMGU_mgv1a018326mg, partial [Mimulus guttatus] Length = 441 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/43 (81%), Positives = 42/43 (97%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 SPGGQLGQGDD+DY+EPTLLD H+SV+AL++SCGFNHTAAIF+ Sbjct: 399 SPGGQLGQGDDVDYIEPTLLDFHKSVEALQVSCGFNHTAAIFQ 441 >gb|EPS70900.1| hypothetical protein M569_03859, partial [Genlisea aurea] Length = 414 Score = 73.6 bits (179), Expect = 3e-11 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 SPGGQLGQGDD+DY EP +++H VK L+ISCGFNHTAAIF+ Sbjct: 372 SPGGQLGQGDDVDYTEPVSVEVHGDVKPLQISCGFNHTAAIFQ 414 >ref|XP_006345747.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X3 [Solanum tuberosum] Length = 417 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFELS 304 S GGQLGQG+D+DY++PT ++ VKAL++SCGFNHT AIFE S Sbjct: 373 SSGGQLGQGNDVDYIKPTKINFPRHVKALQVSCGFNHTGAIFEYS 417 >ref|XP_006345746.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Solanum tuberosum] Length = 418 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFELS 304 S GGQLGQG+D+DY++PT ++ VKAL++SCGFNHT AIFE S Sbjct: 374 SSGGQLGQGNDVDYIKPTKINFPRHVKALQVSCGFNHTGAIFEYS 418 >ref|XP_006345745.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Solanum tuberosum] Length = 419 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFELS 304 S GGQLGQG+D+DY++PT ++ VKAL++SCGFNHT AIFE S Sbjct: 375 SSGGQLGQGNDVDYIKPTKINFPRHVKALQVSCGFNHTGAIFEYS 419 >ref|XP_004239624.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like [Solanum lycopersicum] Length = 419 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 S GGQLGQG+D+DY++PT ++ VKAL++SCGFNHT AIFE Sbjct: 375 SSGGQLGQGNDVDYIKPTKINFRRHVKALQVSCGFNHTGAIFE 417 >ref|XP_004161671.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like [Cucumis sativus] Length = 263 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 S GGQLG G D+DYV+PT +DL E+VK +++SCGFNHT AI E Sbjct: 219 SSGGQLGHGSDVDYVKPTKIDLGENVKVVQVSCGFNHTGAILE 261 >ref|XP_004144697.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like [Cucumis sativus] Length = 481 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 S GGQLG G D+DYV+PT +DL E+VK +++SCGFNHT AI E Sbjct: 437 SSGGQLGHGSDVDYVKPTKIDLGENVKVVQVSCGFNHTGAILE 479 >ref|XP_007048577.1| Regulator of chromosome condensation (RCC1) family protein isoform 2 [Theobroma cacao] gi|508700838|gb|EOX92734.1| Regulator of chromosome condensation (RCC1) family protein isoform 2 [Theobroma cacao] Length = 423 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 S GGQLG G D+DY++PT++ E+VKAL+ISCGFNHT AI E Sbjct: 379 SSGGQLGHGSDVDYIKPTMVHFGENVKALQISCGFNHTGAILE 421 >ref|XP_007048576.1| Regulator of chromosome condensation (RCC1) family protein isoform 1 [Theobroma cacao] gi|508700837|gb|EOX92733.1| Regulator of chromosome condensation (RCC1) family protein isoform 1 [Theobroma cacao] Length = 426 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 S GGQLG G D+DY++PT++ E+VKAL+ISCGFNHT AI E Sbjct: 382 SSGGQLGHGSDVDYIKPTMVHFGENVKALQISCGFNHTGAILE 424 >ref|XP_006491926.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like isoform X12 [Citrus sinensis] Length = 384 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 S GGQLG G+D+DY+ PT+++ E+VKAL++SCGFNHT A+ E Sbjct: 340 SSGGQLGHGNDVDYIHPTIVNFGENVKALQVSCGFNHTGALLE 382 >ref|XP_006491925.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like isoform X11 [Citrus sinensis] Length = 402 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 S GGQLG G+D+DY+ PT+++ E+VKAL++SCGFNHT A+ E Sbjct: 358 SSGGQLGHGNDVDYIHPTIVNFGENVKALQVSCGFNHTGALLE 400 >ref|XP_006491924.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like isoform X10 [Citrus sinensis] Length = 423 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 S GGQLG G+D+DY+ PT+++ E+VKAL++SCGFNHT A+ E Sbjct: 379 SSGGQLGHGNDVDYIHPTIVNFGENVKALQVSCGFNHTGALLE 421 >ref|XP_006491923.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like isoform X9 [Citrus sinensis] Length = 430 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 S GGQLG G+D+DY+ PT+++ E+VKAL++SCGFNHT A+ E Sbjct: 386 SSGGQLGHGNDVDYIHPTIVNFGENVKALQVSCGFNHTGALLE 428 >ref|XP_006491915.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like isoform X1 [Citrus sinensis] gi|568877820|ref|XP_006491916.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like isoform X2 [Citrus sinensis] gi|568877822|ref|XP_006491917.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like isoform X3 [Citrus sinensis] gi|568877824|ref|XP_006491918.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like isoform X4 [Citrus sinensis] gi|568877826|ref|XP_006491919.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like isoform X5 [Citrus sinensis] gi|568877828|ref|XP_006491920.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like isoform X6 [Citrus sinensis] gi|568877830|ref|XP_006491921.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like isoform X7 [Citrus sinensis] gi|568877832|ref|XP_006491922.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4-like isoform X8 [Citrus sinensis] Length = 454 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 S GGQLG G+D+DY+ PT+++ E+VKAL++SCGFNHT A+ E Sbjct: 410 SSGGQLGHGNDVDYIHPTIVNFGENVKALQVSCGFNHTGALLE 452 >ref|XP_002273073.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 [Vitis vinifera] gi|296082630|emb|CBI21635.3| unnamed protein product [Vitis vinifera] Length = 420 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 S GGQLGQG D+D+++P +++ ESV+AL++SCGFNHT AI E Sbjct: 374 SSGGQLGQGSDVDHIKPKMVEFEESVRALQVSCGFNHTGAILE 416 >ref|XP_006856653.1| hypothetical protein AMTR_s00054p00031170 [Amborella trichopoda] gi|548860553|gb|ERN18120.1| hypothetical protein AMTR_s00054p00031170 [Amborella trichopoda] Length = 418 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 S GGQLG G+D DY EPT +D ++ KAL +SCGFNHT AIFE Sbjct: 374 SSGGQLGHGNDFDYFEPTRVDFMKNAKALHVSCGFNHTGAIFE 416 >dbj|BAJ84921.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 419 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 S GGQLG G+D+DY EP +++LH++ +A+ +SCGFNHT AI E Sbjct: 373 SSGGQLGHGNDVDYCEPMMVELHKNARAVHVSCGFNHTGAILE 415 >ref|NP_680156.2| regulator of chromosome condensation repeat-containing protein [Arabidopsis thaliana] gi|26452773|dbj|BAC43467.1| unknown protein [Arabidopsis thaliana] gi|28973187|gb|AAO63918.1| putative UVB-resistance protein UVR8 [Arabidopsis thaliana] gi|332003957|gb|AED91340.1| regulator of chromosome condensation repeat-containing protein [Arabidopsis thaliana] Length = 434 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 S GGQLG G D+DY P ++DL ++V+A+ ISCGFNHTAA+ E Sbjct: 390 SSGGQLGHGSDVDYARPAMVDLGKNVRAVHISCGFNHTAAVLE 432 >ref|XP_003602697.1| X-linked retinitis pigmentosa GTPase regulator [Medicago truncatula] gi|355491745|gb|AES72948.1| X-linked retinitis pigmentosa GTPase regulator [Medicago truncatula] Length = 244 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -3 Query: 438 SPGGQLGQGDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 310 S GGQLG G D+DY+ P+ + E VKAL++SCGFNHT AIFE Sbjct: 200 SSGGQLGHGSDVDYINPSRVCFAEDVKALQVSCGFNHTGAIFE 242