BLASTX nr result
ID: Mentha24_contig00016832
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00016832 (785 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348741.1| PREDICTED: 26S proteasome non-ATPase regulat... 60 7e-07 ref|XP_004239103.1| PREDICTED: 26S proteasome non-ATPase regulat... 60 7e-07 gb|EYU31193.1| hypothetical protein MIMGU_mgv1a006993mg [Mimulus... 60 9e-07 gb|EPS69667.1| hypothetical protein M569_05097 [Genlisea aurea] 60 1e-06 gb|ACG31862.1| 26S proteasome non-ATPase regulatory subunit 11 [... 60 1e-06 ref|NP_001132072.1| uncharacterized protein LOC100193485 [Zea ma... 60 1e-06 gb|ACU24389.1| unknown [Glycine max] 59 2e-06 gb|ACU20905.1| unknown [Glycine max] 59 2e-06 ref|XP_002443517.1| hypothetical protein SORBIDRAFT_08g020840 [S... 59 2e-06 ref|XP_002315028.1| 19S proteosome subunit 9 family protein [Pop... 59 2e-06 ref|XP_002311105.1| 19S proteosome subunit 9 family protein [Pop... 59 2e-06 gb|ABK95007.1| unknown [Populus trichocarpa] 59 2e-06 gb|EXC20292.1| 26S proteasome non-ATPase regulatory subunit 11 [... 59 2e-06 ref|XP_007045996.1| 26S proteasome non-ATPase regulatory subunit... 59 2e-06 ref|XP_007222547.1| hypothetical protein PRUPE_ppa006204mg [Prun... 59 2e-06 ref|XP_004143110.1| PREDICTED: 26S proteasome non-ATPase regulat... 59 2e-06 gb|AFD50340.1| NAC domain protein, partial [Origanum vulgare] 59 2e-06 gb|AFD50337.1| NAC domain protein, partial [Mentha sp. MC-2012] ... 59 2e-06 ref|XP_002062776.1| GK19517 [Drosophila willistoni] gi|194158861... 59 2e-06 ref|XP_002277010.1| PREDICTED: 26S proteasome non-ATPase regulat... 59 2e-06 >ref|XP_006348741.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Solanum tuberosum] Length = 423 Score = 60.5 bits (145), Expect = 7e-07 Identities = 32/51 (62%), Positives = 37/51 (72%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA 409 S+ TL EQNL RLI+PFSRV+ HI ELP+ VEKKLS MI+DKK A Sbjct: 325 SLYDTLMEQNLCRLIEPFSRVEIAHIAELIELPADHVEKKLSQMILDKKFA 375 >ref|XP_004239103.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like [Solanum lycopersicum] Length = 423 Score = 60.5 bits (145), Expect = 7e-07 Identities = 32/51 (62%), Positives = 37/51 (72%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA 409 S+ TL EQNL RLI+PFSRV+ HI ELP+ VEKKLS MI+DKK A Sbjct: 325 SLYDTLMEQNLCRLIEPFSRVEIAHIAELIELPADHVEKKLSQMILDKKFA 375 >gb|EYU31193.1| hypothetical protein MIMGU_mgv1a006993mg [Mimulus guttatus] Length = 423 Score = 60.1 bits (144), Expect = 9e-07 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA 409 S+ TL EQNL RLI+PFSRV+ HI ELP VEKKLS MI+DKK A Sbjct: 325 SLYDTLLEQNLCRLIEPFSRVEIAHIAELIELPGQSVEKKLSQMILDKKFA 375 >gb|EPS69667.1| hypothetical protein M569_05097 [Genlisea aurea] Length = 423 Score = 59.7 bits (143), Expect = 1e-06 Identities = 32/51 (62%), Positives = 37/51 (72%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA 409 S+ TL EQNL RLI+PFSRV+ HI ELP+ VEKKLS MI+DKK A Sbjct: 325 SLYDTLLEQNLCRLIEPFSRVEIAHIAELIELPAPHVEKKLSQMILDKKFA 375 >gb|ACG31862.1| 26S proteasome non-ATPase regulatory subunit 11 [Zea mays] Length = 426 Score = 59.7 bits (143), Expect = 1e-06 Identities = 37/73 (50%), Positives = 44/73 (60%), Gaps = 3/73 (4%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA*A---SCGS 391 S+ TL EQNL RLI+P+SRV+ HI ELP + VEKKLS MI+DKK A G Sbjct: 328 SLYDTLLEQNLCRLIEPYSRVEIAHIAEMIELPMNHVEKKLSQMILDKKFAGTLDQGAGC 387 Query: 390 IKIFLSSGVEISF 352 + IF S E F Sbjct: 388 LIIFEDSKTEEIF 400 >ref|NP_001132072.1| uncharacterized protein LOC100193485 [Zea mays] gi|194693348|gb|ACF80758.1| unknown [Zea mays] Length = 426 Score = 59.7 bits (143), Expect = 1e-06 Identities = 37/73 (50%), Positives = 44/73 (60%), Gaps = 3/73 (4%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA*A---SCGS 391 S+ TL EQNL RLI+P+SRV+ HI ELP + VEKKLS MI+DKK A G Sbjct: 328 SLYDTLLEQNLCRLIEPYSRVEIAHIAEMIELPMNHVEKKLSQMILDKKFAGTLDQGAGC 387 Query: 390 IKIFLSSGVEISF 352 + IF S E F Sbjct: 388 LIIFEDSKTEEIF 400 >gb|ACU24389.1| unknown [Glycine max] Length = 422 Score = 59.3 bits (142), Expect = 2e-06 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA 409 S+ TL EQNL RLI+PFSRV+ HI ELP+ VE+KLS MI+DKK A Sbjct: 324 SLYDTLMEQNLCRLIEPFSRVEIAHIAELIELPTDHVERKLSQMILDKKFA 374 >gb|ACU20905.1| unknown [Glycine max] Length = 487 Score = 59.3 bits (142), Expect = 2e-06 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA 409 S+ TL EQNL RLI+PFSRV+ HI ELP+ VE+KLS MI+DKK A Sbjct: 324 SLYDTLMEQNLCRLIEPFSRVEIAHIAELIELPTDHVERKLSQMILDKKFA 374 >ref|XP_002443517.1| hypothetical protein SORBIDRAFT_08g020840 [Sorghum bicolor] gi|241944210|gb|EES17355.1| hypothetical protein SORBIDRAFT_08g020840 [Sorghum bicolor] Length = 426 Score = 59.3 bits (142), Expect = 2e-06 Identities = 37/73 (50%), Positives = 44/73 (60%), Gaps = 3/73 (4%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA*A---SCGS 391 S+ TL EQNL RLI+P+SRV+ HI ELP + VEKKLS MI+DKK A G Sbjct: 328 SLYDTLLEQNLCRLIEPYSRVEIAHIAEMIELPINHVEKKLSQMILDKKFAGTLDQGAGC 387 Query: 390 IKIFLSSGVEISF 352 + IF S E F Sbjct: 388 LIIFEDSKTEEIF 400 >ref|XP_002315028.1| 19S proteosome subunit 9 family protein [Populus trichocarpa] gi|222864068|gb|EEF01199.1| 19S proteosome subunit 9 family protein [Populus trichocarpa] Length = 422 Score = 59.3 bits (142), Expect = 2e-06 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA 409 S+ TL EQNL RLI+PFSRV+ HI ELP VEKKLS MI+DKK A Sbjct: 324 SLYDTLLEQNLCRLIEPFSRVEIAHIADLIELPIDHVEKKLSQMILDKKFA 374 >ref|XP_002311105.1| 19S proteosome subunit 9 family protein [Populus trichocarpa] gi|222850925|gb|EEE88472.1| 19S proteosome subunit 9 family protein [Populus trichocarpa] Length = 422 Score = 59.3 bits (142), Expect = 2e-06 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA 409 S+ TL EQNL RLI+PFSRV+ HI ELP VEKKLS MI+DKK A Sbjct: 324 SLYDTLLEQNLCRLIEPFSRVEIAHIADLIELPIDHVEKKLSQMILDKKFA 374 >gb|ABK95007.1| unknown [Populus trichocarpa] Length = 310 Score = 59.3 bits (142), Expect = 2e-06 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA 409 S+ TL EQNL RLI+PFSRV+ HI ELP VEKKLS MI+DKK A Sbjct: 212 SLYDTLLEQNLCRLIEPFSRVEIAHIADLIELPIDHVEKKLSQMILDKKFA 262 >gb|EXC20292.1| 26S proteasome non-ATPase regulatory subunit 11 [Morus notabilis] Length = 425 Score = 58.9 bits (141), Expect = 2e-06 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA 409 S+ TL EQNL RLI+PFSRV+ HI ELP VEKKLS MI+DKK A Sbjct: 327 SLYDTLLEQNLCRLIEPFSRVEIAHIAELIELPVDHVEKKLSQMILDKKFA 377 >ref|XP_007045996.1| 26S proteasome non-ATPase regulatory subunit 11 [Theobroma cacao] gi|508709931|gb|EOY01828.1| 26S proteasome non-ATPase regulatory subunit 11 [Theobroma cacao] Length = 422 Score = 58.9 bits (141), Expect = 2e-06 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA 409 S+ TL EQNL RLI+PFSRV+ HI ELP VEKKLS MI+DKK A Sbjct: 324 SLYDTLLEQNLCRLIEPFSRVEIAHIAELIELPVDHVEKKLSQMILDKKFA 374 >ref|XP_007222547.1| hypothetical protein PRUPE_ppa006204mg [Prunus persica] gi|462419483|gb|EMJ23746.1| hypothetical protein PRUPE_ppa006204mg [Prunus persica] Length = 422 Score = 58.9 bits (141), Expect = 2e-06 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA 409 S+ TL EQNL RLI+PFSRV+ HI ELP VEKKLS MI+DKK A Sbjct: 324 SLYDTLLEQNLCRLIEPFSRVEIAHIAELIELPIDHVEKKLSQMILDKKFA 374 >ref|XP_004143110.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like isoform 1 [Cucumis sativus] gi|449450722|ref|XP_004143111.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like isoform 2 [Cucumis sativus] gi|449450724|ref|XP_004143112.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like isoform 3 [Cucumis sativus] gi|449529373|ref|XP_004171674.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like isoform 1 [Cucumis sativus] gi|449529375|ref|XP_004171675.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like isoform 2 [Cucumis sativus] gi|449529377|ref|XP_004171676.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like isoform 3 [Cucumis sativus] Length = 422 Score = 58.9 bits (141), Expect = 2e-06 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA 409 S+ TL EQNL RLI+PFSRV+ HI ELP VEKKLS MI+DKK A Sbjct: 324 SLYDTLLEQNLCRLIEPFSRVEIAHIAELIELPLDHVEKKLSQMILDKKFA 374 >gb|AFD50340.1| NAC domain protein, partial [Origanum vulgare] Length = 145 Score = 58.9 bits (141), Expect = 2e-06 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -3 Query: 549 TLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MI 427 TL EQNL RLI+PFSRV+ HI ELPSHQVEKKLS MI Sbjct: 103 TLQEQNLCRLIEPFSRVEIAHIAELIELPSHQVEKKLSQMI 143 >gb|AFD50337.1| NAC domain protein, partial [Mentha sp. MC-2012] gi|380293381|gb|AFD50338.1| NAC domain protein, partial [Mentha spicata] Length = 145 Score = 58.9 bits (141), Expect = 2e-06 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -3 Query: 549 TLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MI 427 TL EQNL RLI+PFSRV+ HI ELPSHQVEKKLS MI Sbjct: 103 TLQEQNLCRLIEPFSRVEIAHIAELIELPSHQVEKKLSQMI 143 >ref|XP_002062776.1| GK19517 [Drosophila willistoni] gi|194158861|gb|EDW73762.1| GK19517 [Drosophila willistoni] Length = 425 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -3 Query: 549 TLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA 409 T+ EQNL R+I+P+SRV TH+ S +LP QVEKKLS MI+DKK + Sbjct: 332 TMLEQNLCRIIEPYSRVQVTHVAESIQLPMPQVEKKLSQMILDKKFS 378 >ref|XP_002277010.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 isoform 2 [Vitis vinifera] gi|225451257|ref|XP_002276988.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 isoform 1 [Vitis vinifera] gi|359487820|ref|XP_003633654.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 [Vitis vinifera] gi|147811910|emb|CAN63723.1| hypothetical protein VITISV_021756 [Vitis vinifera] Length = 422 Score = 58.9 bits (141), Expect = 2e-06 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -3 Query: 561 SMTCTLHEQNLYRLIKPFSRVDTTHIVGSFELPSHQVEKKLS*MIMDKKMA 409 S+ TL EQNL RLI+PFSRV+ HI ELP VEKKLS MI+DKK A Sbjct: 324 SLYDTLLEQNLCRLIEPFSRVEIAHIAELIELPVDHVEKKLSQMILDKKFA 374