BLASTX nr result
ID: Mentha24_contig00016475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00016475 (695 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21817.1| hypothetical protein MIMGU_mgv1a0008302mg, partia... 88 3e-15 gb|EPS65115.1| hypothetical protein M569_09665, partial [Genlise... 58 3e-06 gb|EPS65114.1| hypothetical protein M569_09664 [Genlisea aurea] 57 4e-06 gb|EYU21815.1| hypothetical protein MIMGU_mgv1a001429mg [Mimulus... 57 8e-06 >gb|EYU21817.1| hypothetical protein MIMGU_mgv1a0008302mg, partial [Mimulus guttatus] Length = 142 Score = 87.8 bits (216), Expect = 3e-15 Identities = 44/75 (58%), Positives = 56/75 (74%), Gaps = 2/75 (2%) Frame = -1 Query: 683 EGYKPSVTTCSILAYGLQRVGHKEELHKVVDAMVSHGWVPPSMSLNELVNQYERVDIQSD 504 EGYKPSV TC LAYGL+RVG+KE + KV+D MV GWVPPSMSLN+L+ QY+R ++ S Sbjct: 69 EGYKPSVATCGTLAYGLKRVGYKE-VDKVLDVMVRFGWVPPSMSLNDLIGQYQRGNLDSK 127 Query: 503 HSI--*AAPEVVCLI 465 + + AA E+ C I Sbjct: 128 NEVSGLAANEIACQI 142 >gb|EPS65115.1| hypothetical protein M569_09665, partial [Genlisea aurea] Length = 368 Score = 58.2 bits (139), Expect = 3e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +1 Query: 1 RGANPETADKQGKTPLQLLAESAIDDVEILALIKTA 108 RGANPE D G+TPLQLLAES+IDDVE+LAL+K+A Sbjct: 330 RGANPEARDNDGRTPLQLLAESSIDDVELLALMKSA 365 >gb|EPS65114.1| hypothetical protein M569_09664 [Genlisea aurea] Length = 1012 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -1 Query: 692 MREEGYKP-SVTTCSILAYGLQRVGHKEELHKVVDAMVSHGWVPPSMSLNELVNQYE 525 M+ EGY P + +CSIL YGL+R G EE+ KV D+MVS GWVP SLN+L+ E Sbjct: 949 MKREGYTPPTANSCSILLYGLKRFGC-EEVDKVYDSMVSFGWVPSVSSLNDLLLSLE 1004 >gb|EYU21815.1| hypothetical protein MIMGU_mgv1a001429mg [Mimulus guttatus] Length = 821 Score = 56.6 bits (135), Expect = 8e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 RGANPETADKQGKTPLQLLAESAIDDVEILALIKTA 108 RGANPE DK+G+TP QLL+ES IDDVE+LAL+K A Sbjct: 784 RGANPEAVDKEGRTPYQLLSESDIDDVELLALMKNA 819