BLASTX nr result
ID: Mentha24_contig00016396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00016396 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19288.1| hypothetical protein MIMGU_mgv1a022146mg, partial... 90 4e-16 >gb|EYU19288.1| hypothetical protein MIMGU_mgv1a022146mg, partial [Mimulus guttatus] Length = 687 Score = 89.7 bits (221), Expect = 4e-16 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 1/65 (1%) Frame = -3 Query: 343 LTHWRKKLVEESVNLLPEVLQQQLKSGNLPEVAVFDGNQNTPPKSNL-PTVQEPILGNLL 167 ++HWRK LV +SV+LLP+VLQQQLKSGNLPEV VF N+N KSN TVQEPILGNLL Sbjct: 623 MSHWRKGLVGQSVDLLPDVLQQQLKSGNLPEVGVFPNNENISVKSNFGATVQEPILGNLL 682 Query: 166 FRVPQ 152 F P+ Sbjct: 683 FNAPK 687