BLASTX nr result
ID: Mentha24_contig00016202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00016202 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46510.1| hypothetical protein MIMGU_mgv1a013084mg [Mimulus... 73 5e-11 gb|AFK44393.1| unknown [Lotus japonicus] 73 5e-11 gb|AFK37379.1| unknown [Medicago truncatula] 73 5e-11 ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medi... 73 5e-11 emb|CAH59413.1| auxin resistance protein [Plantago major] 72 6e-11 ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16-li... 71 1e-10 gb|ACL81167.1| auxin-responsive protein IAA1, partial [Mirabilis... 71 1e-10 gb|AAM96891.1| auxin-responsive protein IAA1 [Mirabilis jalapa] 71 1e-10 gb|AAN16886.1| Aux/IAA1 [Mirabilis jalapa] 71 1e-10 ref|XP_006383686.1| auxin-induced protein aux28 [Populus trichoc... 71 2e-10 ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max] gi... 71 2e-10 ref|XP_002302075.1| auxin-induced protein aux28 [Populus trichoc... 71 2e-10 ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 ... 70 3e-10 ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prun... 70 3e-10 emb|CBI26357.3| unnamed protein product [Vitis vinifera] 70 3e-10 ref|XP_002284143.1| PREDICTED: auxin-responsive protein IAA14-li... 70 3e-10 ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14-li... 70 3e-10 ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Popu... 70 3e-10 gb|ACD63779.1| indoleacetic acid-induced-like protein, partial [... 70 3e-10 ref|XP_006664171.1| PREDICTED: auxin-responsive protein IAA30-li... 70 4e-10 >gb|EYU46510.1| hypothetical protein MIMGU_mgv1a013084mg [Mimulus guttatus] Length = 231 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNR 277 VPWEMFVGSCKRLRIMKGTEAKGLAP+AM+KCK R Sbjct: 196 VPWEMFVGSCKRLRIMKGTEAKGLAPKAMDKCKTR 230 >gb|AFK44393.1| unknown [Lotus japonicus] Length = 242 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNR 277 VPWEMFVGSCKRLRIMKG+EA GLAPRAMEKCKNR Sbjct: 207 VPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNR 241 >gb|AFK37379.1| unknown [Medicago truncatula] Length = 236 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNR 277 VPWEMFVGSCKRLRIMKG+EA GLAPRAMEKCKNR Sbjct: 201 VPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNR 235 >ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula] gi|355480854|gb|AES62057.1| Indoleacetic acid-induced-like protein [Medicago truncatula] Length = 236 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNR 277 VPWEMFVGSCKRLRIMKG+EA GLAPRAMEKCKNR Sbjct: 201 VPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNR 235 >emb|CAH59413.1| auxin resistance protein [Plantago major] Length = 227 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNR 277 VPWEMFVGSCKRLRIMKGTEA GLAPRAMEKCK+R Sbjct: 192 VPWEMFVGSCKRLRIMKGTEAIGLAPRAMEKCKSR 226 >ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16-like [Cicer arietinum] Length = 252 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNR 277 VPWEMFVGSCKRLRIMKG+EA GLAPRA+EKCKNR Sbjct: 217 VPWEMFVGSCKRLRIMKGSEAIGLAPRAVEKCKNR 251 >gb|ACL81167.1| auxin-responsive protein IAA1, partial [Mirabilis jalapa] Length = 263 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNRI 274 VPWEMFV SCKRLRIMKG EA GLAPRAMEKCKNRI Sbjct: 228 VPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNRI 263 >gb|AAM96891.1| auxin-responsive protein IAA1 [Mirabilis jalapa] Length = 194 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNRI 274 VPWEMFV SCKRLRIMKG EA GLAPRAMEKCKNRI Sbjct: 159 VPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNRI 194 >gb|AAN16886.1| Aux/IAA1 [Mirabilis jalapa] Length = 97 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNRI 274 VPWEMFV SCKRLRIMKG EA GLAPRAMEKCKNRI Sbjct: 62 VPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNRI 97 >ref|XP_006383686.1| auxin-induced protein aux28 [Populus trichocarpa] gi|550339636|gb|ERP61483.1| auxin-induced protein aux28 [Populus trichocarpa] Length = 237 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNR 277 VPW+MFV SCKRLRIMKGTEA GLAPRAMEKCKNR Sbjct: 200 VPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKNR 234 >ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max] gi|238058427|gb|ACR39367.1| Aux/IAA protein [Glycine max] Length = 239 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNR 277 VPWEMFVGSCKRLRIMKG+EA GLAPRAMEKCK+R Sbjct: 204 VPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKSR 238 >ref|XP_002302075.1| auxin-induced protein aux28 [Populus trichocarpa] gi|222843801|gb|EEE81348.1| auxin-induced protein aux28 [Populus trichocarpa] gi|429326564|gb|AFZ78622.1| hypothetical protein [Populus tomentosa] Length = 237 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNR 277 VPW+MFV SCKRLRIMKGTEA GLAPRAMEKCKNR Sbjct: 200 VPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKNR 234 >ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao] gi|508702682|gb|EOX94578.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao] Length = 305 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNR 277 VPW+MFV SCKRLRIMKGTEA GLAPRAMEKCKNR Sbjct: 270 VPWDMFVESCKRLRIMKGTEAIGLAPRAMEKCKNR 304 >ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica] gi|462420746|gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica] Length = 239 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNR 277 VPWEMFV SCKRLRIMKG+EA GLAPRAMEKCKNR Sbjct: 204 VPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR 238 >emb|CBI26357.3| unnamed protein product [Vitis vinifera] Length = 237 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNR 277 VPWEMFV SCKRLRIMKG+EA GLAPRAMEKCKNR Sbjct: 202 VPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR 236 >ref|XP_002284143.1| PREDICTED: auxin-responsive protein IAA14-like isoform 3 [Vitis vinifera] Length = 230 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNR 277 VPWEMFV SCKRLRIMKG+EA GLAPRAMEKCKNR Sbjct: 195 VPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR 229 >ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14-like isoform 1 [Vitis vinifera] Length = 243 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNR 277 VPWEMFV SCKRLRIMKG+EA GLAPRAMEKCKNR Sbjct: 208 VPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR 242 >ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa] gi|222857451|gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa] Length = 246 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNRI 274 VPWEMFV SCKRLRIMKG+EA GLAPRA+EKCKNRI Sbjct: 211 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRI 246 >gb|ACD63779.1| indoleacetic acid-induced-like protein, partial [Helianthus annuus] gi|188569409|gb|ACD63783.1| indoleacetic acid-induced-like protein, partial [Helianthus annuus] gi|188569411|gb|ACD63784.1| indoleacetic acid-induced-like protein, partial [Helianthus annuus] gi|188569413|gb|ACD63785.1| indoleacetic acid-induced-like protein, partial [Helianthus annuus] Length = 41 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNRI 274 VPWEMFV SCKRLRIMKG EA GLAPRAMEKCKNR+ Sbjct: 6 VPWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNRL 41 >ref|XP_006664171.1| PREDICTED: auxin-responsive protein IAA30-like [Oryza brachyantha] Length = 248 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 381 VPWEMFVGSCKRLRIMKGTEAKGLAPRAMEKCKNR 277 VPWEMFV SCKRLRIMKG+EA GLAPRAMEKCKNR Sbjct: 213 VPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR 247