BLASTX nr result
ID: Mentha24_contig00016049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00016049 (590 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17498.1| hypothetical protein MIMGU_mgv1a002335mg [Mimulus... 106 4e-21 dbj|BAB10204.1| maize crp1 protein-like [Arabidopsis thaliana] 103 3e-20 ref|XP_006279580.1| hypothetical protein CARUB_v10025981mg [Caps... 103 3e-20 ref|XP_002865541.1| pentatricopeptide repeat-containing protein ... 103 3e-20 ref|NP_199046.1| pentatricopeptide repeat-containing protein [Ar... 103 3e-20 ref|XP_003527377.1| PREDICTED: pentatricopeptide repeat-containi... 103 4e-20 ref|XP_003523110.1| PREDICTED: pentatricopeptide repeat-containi... 103 4e-20 gb|EXB56341.1| hypothetical protein L484_024883 [Morus notabilis] 103 5e-20 ref|XP_002306972.1| hypothetical protein POPTR_0005s27160g [Popu... 102 8e-20 ref|XP_006473771.1| PREDICTED: pentatricopeptide repeat-containi... 102 1e-19 ref|XP_006473770.1| PREDICTED: pentatricopeptide repeat-containi... 102 1e-19 ref|XP_006435342.1| hypothetical protein CICLE_v10000451mg [Citr... 102 1e-19 ref|XP_006405260.1| hypothetical protein EUTSA_v10027665mg [Eutr... 102 1e-19 ref|XP_002510663.1| pentatricopeptide repeat-containing protein,... 102 1e-19 ref|XP_007136014.1| hypothetical protein PHAVU_009G010700g [Phas... 101 1e-19 ref|XP_004500883.1| PREDICTED: pentatricopeptide repeat-containi... 101 1e-19 ref|XP_004292910.1| PREDICTED: pentatricopeptide repeat-containi... 101 1e-19 ref|XP_002272226.1| PREDICTED: pentatricopeptide repeat-containi... 101 1e-19 emb|CAN83144.1| hypothetical protein VITISV_040783 [Vitis vinifera] 101 1e-19 ref|XP_007225185.1| hypothetical protein PRUPE_ppa002191mg [Prun... 101 2e-19 >gb|EYU17498.1| hypothetical protein MIMGU_mgv1a002335mg [Mimulus guttatus] Length = 687 Score = 106 bits (265), Expect = 4e-21 Identities = 51/56 (91%), Positives = 56/56 (100%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 ILA+NSL+NAFGEDRRD+EAFAVLQYMKDN+LKPDVVTYTTLMKALIRV+KYEKVP Sbjct: 598 ILAMNSLVNAFGEDRRDSEAFAVLQYMKDNDLKPDVVTYTTLMKALIRVEKYEKVP 653 >dbj|BAB10204.1| maize crp1 protein-like [Arabidopsis thaliana] Length = 680 Score = 103 bits (258), Expect = 3e-20 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 +LALNSLINAFGEDRRDAEAFAVLQYMK+N +KPDVVTYTTLMKALIRVDK++KVP Sbjct: 590 LLALNSLINAFGEDRRDAEAFAVLQYMKENGVKPDVVTYTTLMKALIRVDKFQKVP 645 >ref|XP_006279580.1| hypothetical protein CARUB_v10025981mg [Capsella rubella] gi|482548284|gb|EOA12478.1| hypothetical protein CARUB_v10025981mg [Capsella rubella] Length = 708 Score = 103 bits (258), Expect = 3e-20 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 +LALNSLINAFGEDRRDAEAFAVLQYMK+N +KPDVVTYTTLMKALIRVDK++KVP Sbjct: 618 LLALNSLINAFGEDRRDAEAFAVLQYMKENGVKPDVVTYTTLMKALIRVDKFQKVP 673 >ref|XP_002865541.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297311376|gb|EFH41800.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 711 Score = 103 bits (258), Expect = 3e-20 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 +LALNSLINAFGEDRRDAEAFAVLQYMK+N +KPDVVTYTTLMKALIRVDK++KVP Sbjct: 621 LLALNSLINAFGEDRRDAEAFAVLQYMKENGVKPDVVTYTTLMKALIRVDKFQKVP 676 >ref|NP_199046.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75154282|sp|Q8L844.1|PP413_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g42310, mitochondrial; Flags: Precursor gi|21539517|gb|AAM53311.1| maize crp1 protein-like [Arabidopsis thaliana] gi|332007411|gb|AED94794.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 709 Score = 103 bits (258), Expect = 3e-20 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 +LALNSLINAFGEDRRDAEAFAVLQYMK+N +KPDVVTYTTLMKALIRVDK++KVP Sbjct: 619 LLALNSLINAFGEDRRDAEAFAVLQYMKENGVKPDVVTYTTLMKALIRVDKFQKVP 674 >ref|XP_003527377.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Glycine max] Length = 696 Score = 103 bits (257), Expect = 4e-20 Identities = 49/56 (87%), Positives = 56/56 (100%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 +LALNSLINAFGEDRRDAEAFAVLQYMK+NN++PDVVTYTTLMKALIRV+K++KVP Sbjct: 607 LLALNSLINAFGEDRRDAEAFAVLQYMKENNIEPDVVTYTTLMKALIRVEKFQKVP 662 >ref|XP_003523110.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Glycine max] Length = 680 Score = 103 bits (257), Expect = 4e-20 Identities = 49/56 (87%), Positives = 56/56 (100%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 +LALNSLINAFGEDRRDAEAFAVLQYMK+NN++PDVVTYTTLMKALIRV+K++KVP Sbjct: 591 LLALNSLINAFGEDRRDAEAFAVLQYMKENNIEPDVVTYTTLMKALIRVEKFQKVP 646 >gb|EXB56341.1| hypothetical protein L484_024883 [Morus notabilis] Length = 734 Score = 103 bits (256), Expect = 5e-20 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 ILALNSLINAFGEDRRDAEAFAVLQYMK+N LKPDVVTYTTLMKAL RVDK++KVP Sbjct: 618 ILALNSLINAFGEDRRDAEAFAVLQYMKENGLKPDVVTYTTLMKALNRVDKFDKVP 673 >ref|XP_002306972.1| hypothetical protein POPTR_0005s27160g [Populus trichocarpa] gi|222856421|gb|EEE93968.1| hypothetical protein POPTR_0005s27160g [Populus trichocarpa] Length = 709 Score = 102 bits (254), Expect = 8e-20 Identities = 49/56 (87%), Positives = 55/56 (98%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 +LALNSLINAFGEDRRDAEAF VLQYMK+N+LKPDVVTYTTLMKALIRV+K++KVP Sbjct: 620 LLALNSLINAFGEDRRDAEAFTVLQYMKENDLKPDVVTYTTLMKALIRVEKFDKVP 675 >ref|XP_006473771.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Citrus sinensis] gi|568839606|ref|XP_006473772.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Citrus sinensis] Length = 99 Score = 102 bits (253), Expect = 1e-19 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = -2 Query: 586 LALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 LALNSLINAFGED+RDAEAFAVLQYMK+N LKPDVVTYTTLMKALIRVDK+ KVP Sbjct: 11 LALNSLINAFGEDQRDAEAFAVLQYMKENGLKPDVVTYTTLMKALIRVDKFHKVP 65 >ref|XP_006473770.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Citrus sinensis] Length = 704 Score = 102 bits (253), Expect = 1e-19 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = -2 Query: 586 LALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 LALNSLINAFGED+RDAEAFAVLQYMK+N LKPDVVTYTTLMKALIRVDK+ KVP Sbjct: 616 LALNSLINAFGEDQRDAEAFAVLQYMKENGLKPDVVTYTTLMKALIRVDKFHKVP 670 >ref|XP_006435342.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|567885569|ref|XP_006435343.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|557537464|gb|ESR48582.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|557537465|gb|ESR48583.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] Length = 704 Score = 102 bits (253), Expect = 1e-19 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = -2 Query: 586 LALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 LALNSLINAFGED+RDAEAFAVLQYMK+N LKPDVVTYTTLMKALIRVDK+ KVP Sbjct: 616 LALNSLINAFGEDQRDAEAFAVLQYMKENGLKPDVVTYTTLMKALIRVDKFHKVP 670 >ref|XP_006405260.1| hypothetical protein EUTSA_v10027665mg [Eutrema salsugineum] gi|557106398|gb|ESQ46713.1| hypothetical protein EUTSA_v10027665mg [Eutrema salsugineum] Length = 704 Score = 102 bits (253), Expect = 1e-19 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 +LALNSLINAFGEDRRDAEAFAVLQYMK+N + PDVVTYTTLMKALIRVDK++KVP Sbjct: 614 LLALNSLINAFGEDRRDAEAFAVLQYMKENGVNPDVVTYTTLMKALIRVDKFQKVP 669 >ref|XP_002510663.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223551364|gb|EEF52850.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 695 Score = 102 bits (253), Expect = 1e-19 Identities = 49/56 (87%), Positives = 55/56 (98%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 +LALNSLINAFGEDRRDAEAF+VL+YMK+N+LKPDVVTYTTLMKALIRVDK+ KVP Sbjct: 606 LLALNSLINAFGEDRRDAEAFSVLKYMKENDLKPDVVTYTTLMKALIRVDKFNKVP 661 >ref|XP_007136014.1| hypothetical protein PHAVU_009G010700g [Phaseolus vulgaris] gi|561009101|gb|ESW08008.1| hypothetical protein PHAVU_009G010700g [Phaseolus vulgaris] Length = 689 Score = 101 bits (252), Expect = 1e-19 Identities = 48/56 (85%), Positives = 55/56 (98%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 +LALNSLINAFGEDRRDAEAFAVLQYMK+NN++PDVVTYTTLMKALIR +K++KVP Sbjct: 600 LLALNSLINAFGEDRRDAEAFAVLQYMKENNIEPDVVTYTTLMKALIRCEKFQKVP 655 >ref|XP_004500883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Cicer arietinum] Length = 691 Score = 101 bits (252), Expect = 1e-19 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 +LALNSLINAFGEDRRDAEAFAVLQYMK+N ++PDVVTYTTLMK+LIRVDKY KVP Sbjct: 602 LLALNSLINAFGEDRRDAEAFAVLQYMKENGVEPDVVTYTTLMKSLIRVDKYPKVP 657 >ref|XP_004292910.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 813 Score = 101 bits (252), Expect = 1e-19 Identities = 49/56 (87%), Positives = 55/56 (98%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 +LALNSLINAFGEDRRDAEAF+VLQYMK+N++KPDVVTYTTLMKALIRVDK+ KVP Sbjct: 723 LLALNSLINAFGEDRRDAEAFSVLQYMKENDVKPDVVTYTTLMKALIRVDKFYKVP 778 >ref|XP_002272226.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Vitis vinifera] gi|297745544|emb|CBI40709.3| unnamed protein product [Vitis vinifera] Length = 695 Score = 101 bits (252), Expect = 1e-19 Identities = 48/56 (85%), Positives = 55/56 (98%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 +L LNSLINAFGEDRRDAEAF+VLQYMK+N+LKPDVVTYTTLMKALIRV+K++KVP Sbjct: 606 VLVLNSLINAFGEDRRDAEAFSVLQYMKENDLKPDVVTYTTLMKALIRVEKFDKVP 661 >emb|CAN83144.1| hypothetical protein VITISV_040783 [Vitis vinifera] Length = 724 Score = 101 bits (252), Expect = 1e-19 Identities = 48/56 (85%), Positives = 55/56 (98%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 +L LNSLINAFGEDRRDAEAF+VLQYMK+N+LKPDVVTYTTLMKALIRV+K++KVP Sbjct: 635 VLVLNSLINAFGEDRRDAEAFSVLQYMKENDLKPDVVTYTTLMKALIRVEKFDKVP 690 >ref|XP_007225185.1| hypothetical protein PRUPE_ppa002191mg [Prunus persica] gi|462422121|gb|EMJ26384.1| hypothetical protein PRUPE_ppa002191mg [Prunus persica] Length = 703 Score = 101 bits (251), Expect = 2e-19 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = -2 Query: 589 ILALNSLINAFGEDRRDAEAFAVLQYMKDNNLKPDVVTYTTLMKALIRVDKYEKVP 422 +LALNSLINAFGEDRRDAEAF+VLQYMK+N+LKPDVVTYTTLMK LIRVDK+ KVP Sbjct: 615 LLALNSLINAFGEDRRDAEAFSVLQYMKENDLKPDVVTYTTLMKTLIRVDKFYKVP 670