BLASTX nr result
ID: Mentha24_contig00014784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00014784 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19533.1| hypothetical protein MIMGU_mgv1a014048mg [Mimulus... 60 2e-07 ref|XP_007038654.1| GTP-binding protein 1 isoform 2 [Theobroma c... 60 2e-07 ref|XP_007038653.1| GTP-binding protein 1 isoform 1 [Theobroma c... 60 2e-07 ref|XP_004249010.1| PREDICTED: ADP-ribosylation factor-related p... 59 9e-07 gb|EPS69351.1| hypothetical protein M569_05414 [Genlisea aurea] 58 2e-06 >gb|EYU19533.1| hypothetical protein MIMGU_mgv1a014048mg [Mimulus guttatus] gi|604299691|gb|EYU19534.1| hypothetical protein MIMGU_mgv1a014048mg [Mimulus guttatus] Length = 202 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +3 Query: 3 AVSAFDGVGIKEGVNWLVDAMGRSKRTETLRIRARSNVV 119 AVSA DG+GIKE VNWLVD+M RSKRT+ LR+RA S+VV Sbjct: 164 AVSAIDGLGIKESVNWLVDSMERSKRTDLLRVRAGSSVV 202 >ref|XP_007038654.1| GTP-binding protein 1 isoform 2 [Theobroma cacao] gi|590672591|ref|XP_007038655.1| GTP-binding protein 1 isoform 2 [Theobroma cacao] gi|508775899|gb|EOY23155.1| GTP-binding protein 1 isoform 2 [Theobroma cacao] gi|508775900|gb|EOY23156.1| GTP-binding protein 1 isoform 2 [Theobroma cacao] Length = 203 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 3 AVSAFDGVGIKEGVNWLVDAMGRSKRTETLRIRA 104 AVSAFDG+GIKEGV WLV+ M RSKRTETLRIRA Sbjct: 164 AVSAFDGMGIKEGVEWLVEVMERSKRTETLRIRA 197 >ref|XP_007038653.1| GTP-binding protein 1 isoform 1 [Theobroma cacao] gi|508775898|gb|EOY23154.1| GTP-binding protein 1 isoform 1 [Theobroma cacao] Length = 248 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 3 AVSAFDGVGIKEGVNWLVDAMGRSKRTETLRIRA 104 AVSAFDG+GIKEGV WLV+ M RSKRTETLRIRA Sbjct: 209 AVSAFDGMGIKEGVEWLVEVMERSKRTETLRIRA 242 >ref|XP_004249010.1| PREDICTED: ADP-ribosylation factor-related protein 1-like [Solanum lycopersicum] gi|565399551|ref|XP_006365313.1| PREDICTED: ADP-ribosylation factor-related protein 1-like [Solanum tuberosum] Length = 204 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +3 Query: 3 AVSAFDGVGIKEGVNWLVDAMGRSKRTETLRIRARSNVV 119 AVS++DG+GIKE VNWLVD M RSKRTE L++RA +N++ Sbjct: 164 AVSSYDGLGIKESVNWLVDVMERSKRTEMLQLRAGANLI 202 >gb|EPS69351.1| hypothetical protein M569_05414 [Genlisea aurea] Length = 202 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +3 Query: 3 AVSAFDGVGIKEGVNWLVDAMGRSKRTETLRIRARSNVV 119 AVSA DG GIKE VNW+V+AM RSKRTE LR+RA S++V Sbjct: 164 AVSAIDGRGIKESVNWIVNAMERSKRTELLRLRAGSSIV 202