BLASTX nr result
ID: Mentha24_contig00014756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00014756 (549 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS62621.1| hypothetical protein M569_12169, partial [Genlise... 70 4e-10 >gb|EPS62621.1| hypothetical protein M569_12169, partial [Genlisea aurea] Length = 284 Score = 69.7 bits (169), Expect = 4e-10 Identities = 39/80 (48%), Positives = 52/80 (65%), Gaps = 1/80 (1%) Frame = -2 Query: 548 QMKNLCNNIFHLMXXXXXXXXXXXXXXXXXXSCAKNT-MKPLDLLPMTRFCEEIQTAVVA 372 QMK+LCNNI+ LM + T +KPLDLLPMT FC+EI+TA+V+ Sbjct: 183 QMKSLCNNIYILMSTFGSGHDSNGKNDRSYNLLSPETAVKPLDLLPMTNFCQEIETAMVS 242 Query: 371 AANGGEESNIRSAAEEISAR 312 AA+ G+ N+RS+AEE+SAR Sbjct: 243 AASNGD--NVRSSAEEMSAR 260