BLASTX nr result
ID: Mentha24_contig00014628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00014628 (402 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631806.1| PREDICTED: uncharacterized protein LOC100257... 56 6e-06 gb|EPS65353.1| hypothetical protein M569_09432 [Genlisea aurea] 55 1e-05 >ref|XP_003631806.1| PREDICTED: uncharacterized protein LOC100257725 [Vitis vinifera] gi|147799467|emb|CAN70605.1| hypothetical protein VITISV_040195 [Vitis vinifera] Length = 66 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/60 (48%), Positives = 40/60 (66%) Frame = +1 Query: 61 LVAAMAIATLFALIGSSAAQESMEPAPPPSMTSSAGVASPSFAIGCAVAVASFIFGSALR 240 L+A M + A++ S A + + PAP P+ SSAG SPSFA GCAVAV +F+FGS ++ Sbjct: 10 LIALMVFSV--AILSSVVAAQDLAPAPSPA--SSAGAISPSFAAGCAVAVVAFVFGSVMK 65 >gb|EPS65353.1| hypothetical protein M569_09432 [Genlisea aurea] Length = 78 Score = 55.1 bits (131), Expect = 1e-05 Identities = 34/73 (46%), Positives = 45/73 (61%), Gaps = 1/73 (1%) Frame = +1 Query: 28 EAAMAMSQTRVLVAAMAIATLFALIGSSAAQESMEPAPPPSMTSSAGVASPSFAIGCAVA 207 E AMA++Q + + A AI +FAL+ +AAQE+ PAP TSS+G+ SPS A Sbjct: 10 EGAMAVTQAGIFMFAAAILVVFALMNGAAAQEAPAPAP----TSSSGIFSPSVGFAFVSA 65 Query: 208 VASF-IFGSALRI 243 V SF +F ALRI Sbjct: 66 VFSFVVFSRALRI 78