BLASTX nr result
ID: Mentha24_contig00014433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00014433 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19886.1| hypothetical protein MIMGU_mgv1a011321mg [Mimulus... 57 3e-06 ref|XP_007147214.1| hypothetical protein PHAVU_006G105300g [Phas... 57 3e-06 ref|XP_003521770.1| PREDICTED: uncharacterized protein LOC100805... 56 6e-06 ref|NP_001240067.1| uncharacterized protein LOC100814672 [Glycin... 56 6e-06 gb|EPS65851.1| hypothetical protein M569_08924, partial [Genlise... 55 8e-06 >gb|EYU19886.1| hypothetical protein MIMGU_mgv1a011321mg [Mimulus guttatus] Length = 285 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 3 AGFVPVLLYNNQELLVTASSALMLYILASYYR 98 AG++P+ LYNNQEL VTAS+ALMLY+LASYY+ Sbjct: 254 AGYIPIFLYNNQELFVTASTALMLYVLASYYK 285 >ref|XP_007147214.1| hypothetical protein PHAVU_006G105300g [Phaseolus vulgaris] gi|561020437|gb|ESW19208.1| hypothetical protein PHAVU_006G105300g [Phaseolus vulgaris] Length = 280 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 6 GFVPVLLYNNQELLVTASSALMLYILASYYR 98 GF+P LLYNNQEL++T SSA+MLYI+ASYYR Sbjct: 250 GFIPALLYNNQELIITTSSAVMLYIMASYYR 280 >ref|XP_003521770.1| PREDICTED: uncharacterized protein LOC100805399 [Glycine max] Length = 282 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 6 GFVPVLLYNNQELLVTASSALMLYILASYYR 98 GF+P LLYN+QEL++T SSALMLYI+ASYYR Sbjct: 252 GFIPTLLYNSQELIITTSSALMLYIMASYYR 282 >ref|NP_001240067.1| uncharacterized protein LOC100814672 [Glycine max] gi|255638094|gb|ACU19361.1| unknown [Glycine max] Length = 282 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 6 GFVPVLLYNNQELLVTASSALMLYILASYYR 98 GF+P LLYN+QEL++T SSALMLYI+ASYYR Sbjct: 252 GFIPTLLYNSQELIITTSSALMLYIMASYYR 282 >gb|EPS65851.1| hypothetical protein M569_08924, partial [Genlisea aurea] Length = 267 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 AGFVPVLLYNNQELLVTASSALMLYILASYYR 98 AGFVP LYNNQEL VT SSALML++LASYYR Sbjct: 236 AGFVPEFLYNNQELFVTVSSALMLHVLASYYR 267