BLASTX nr result
ID: Mentha24_contig00014230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00014230 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS57597.1| hypothetical protein M569_17220, partial [Genlise... 60 3e-07 ref|XP_002962674.1| hypothetical protein SELMODRAFT_438307 [Sela... 57 4e-06 ref|XP_002886219.1| hypothetical protein ARALYDRAFT_319835 [Arab... 56 5e-06 gb|ABR17037.1| unknown [Picea sitchensis] 56 5e-06 ref|XP_006494487.1| PREDICTED: protein RER1C-like isoform X1 [Ci... 56 6e-06 ref|XP_006425971.1| hypothetical protein CICLE_v10026506mg [Citr... 56 6e-06 ref|XP_004966386.1| PREDICTED: protein RER1A-like [Setaria italica] 56 6e-06 ref|XP_005651615.1| retrieval of early ER protein Rer1 [Coccomyx... 56 6e-06 ref|XP_002480972.1| Golgi membrane protein (Rer1), putative [Tal... 56 6e-06 ref|XP_002151967.1| Golgi membrane protein (Rer1), putative [Tal... 56 6e-06 ref|XP_003569310.1| PREDICTED: protein RER1B-like [Brachypodium ... 55 8e-06 ref|XP_003611671.1| RER1A protein [Medicago truncatula] gi|35551... 55 8e-06 dbj|BAJ87134.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 8e-06 >gb|EPS57597.1| hypothetical protein M569_17220, partial [Genlisea aurea] Length = 200 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 1 LLFYWIVLLFLTMKRQIMHMVKYRYIPFNL 90 LLFYW VL LTMKRQIMHM+KYRYIPFNL Sbjct: 168 LLFYWFVLFVLTMKRQIMHMIKYRYIPFNL 197 >ref|XP_002962674.1| hypothetical protein SELMODRAFT_438307 [Selaginella moellendorffii] gi|302797318|ref|XP_002980420.1| hypothetical protein SELMODRAFT_419939 [Selaginella moellendorffii] gi|300152036|gb|EFJ18680.1| hypothetical protein SELMODRAFT_419939 [Selaginella moellendorffii] gi|300169535|gb|EFJ36137.1| hypothetical protein SELMODRAFT_438307 [Selaginella moellendorffii] Length = 192 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 1 LLFYWIVLLFLTMKRQIMHMVKYRYIPFNL 90 L+ YW+VLLFLTMKRQI+HMVK+RYIPF++ Sbjct: 143 LVIYWVVLLFLTMKRQILHMVKHRYIPFSI 172 >ref|XP_002886219.1| hypothetical protein ARALYDRAFT_319835 [Arabidopsis lyrata subsp. lyrata] gi|297332059|gb|EFH62478.1| hypothetical protein ARALYDRAFT_319835 [Arabidopsis lyrata subsp. lyrata] Length = 193 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 1 LLFYWIVLLFLTMKRQIMHMVKYRYIPFNL 90 LLFYWIVL LTM+RQI HM+KY+YIPFNL Sbjct: 146 LLFYWIVLFVLTMRRQIAHMMKYKYIPFNL 175 >gb|ABR17037.1| unknown [Picea sitchensis] Length = 194 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +1 Query: 1 LLFYWIVLLFLTMKRQIMHMVKYRYIPFNL 90 LLFYWIVL LTMKRQI+HM+KY+Y+PF++ Sbjct: 145 LLFYWIVLFMLTMKRQILHMIKYKYVPFSV 174 >ref|XP_006494487.1| PREDICTED: protein RER1C-like isoform X1 [Citrus sinensis] gi|568883460|ref|XP_006494488.1| PREDICTED: protein RER1C-like isoform X2 [Citrus sinensis] gi|568883462|ref|XP_006494489.1| PREDICTED: protein RER1C-like isoform X3 [Citrus sinensis] Length = 205 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +1 Query: 1 LLFYWIVLLFLTMKRQIMHMVKYRYIPFNL 90 LLFYW++L LTM+RQIMHM+KYRY+PF+L Sbjct: 156 LLFYWLMLFTLTMRRQIMHMIKYRYVPFSL 185 >ref|XP_006425971.1| hypothetical protein CICLE_v10026506mg [Citrus clementina] gi|567866699|ref|XP_006425972.1| hypothetical protein CICLE_v10026506mg [Citrus clementina] gi|557527961|gb|ESR39211.1| hypothetical protein CICLE_v10026506mg [Citrus clementina] gi|557527962|gb|ESR39212.1| hypothetical protein CICLE_v10026506mg [Citrus clementina] Length = 205 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +1 Query: 1 LLFYWIVLLFLTMKRQIMHMVKYRYIPFNL 90 LLFYW++L LTM+RQIMHM+KYRY+PF+L Sbjct: 156 LLFYWLMLFTLTMRRQIMHMIKYRYVPFSL 185 >ref|XP_004966386.1| PREDICTED: protein RER1A-like [Setaria italica] Length = 190 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +1 Query: 1 LLFYWIVLLFLTMKRQIMHMVKYRYIPF 84 LL YWIVL FLTMKRQIMHM+KY+Y+PF Sbjct: 143 LLCYWIVLFFLTMKRQIMHMIKYKYVPF 170 >ref|XP_005651615.1| retrieval of early ER protein Rer1 [Coccomyxa subellipsoidea C-169] gi|384253597|gb|EIE27071.1| retrieval of early ER protein Rer1 [Coccomyxa subellipsoidea C-169] Length = 191 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +1 Query: 1 LLFYWIVLLFLTMKRQIMHMVKYRYIPFN 87 LL YW+VLLF+TMKRQI HM+KYRYIPF+ Sbjct: 145 LLMYWLVLLFVTMKRQIKHMIKYRYIPFS 173 >ref|XP_002480972.1| Golgi membrane protein (Rer1), putative [Talaromyces stipitatus ATCC 10500] gi|218721119|gb|EED20538.1| Golgi membrane protein (Rer1), putative [Talaromyces stipitatus ATCC 10500] Length = 189 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +1 Query: 1 LLFYWIVLLFLTMKRQIMHMVKYRYIPFNL 90 L+ YW++L FLTM+RQI HM+KYRYIPFN+ Sbjct: 152 LVMYWLILFFLTMRRQIQHMIKYRYIPFNI 181 >ref|XP_002151967.1| Golgi membrane protein (Rer1), putative [Talaromyces marneffei ATCC 18224] gi|210066874|gb|EEA20967.1| Golgi membrane protein (Rer1), putative [Talaromyces marneffei ATCC 18224] Length = 189 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +1 Query: 1 LLFYWIVLLFLTMKRQIMHMVKYRYIPFNL 90 L+ YW++L FLTM+RQI HM+KYRYIPFN+ Sbjct: 152 LVMYWLILFFLTMRRQIQHMIKYRYIPFNI 181 >ref|XP_003569310.1| PREDICTED: protein RER1B-like [Brachypodium distachyon] Length = 202 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 1 LLFYWIVLLFLTMKRQIMHMVKYRYIPFNL 90 LL YWIVL LTMKRQI+HMVKY+Y+PFN+ Sbjct: 154 LLCYWIVLFVLTMKRQILHMVKYKYVPFNI 183 >ref|XP_003611671.1| RER1A protein [Medicago truncatula] gi|355513006|gb|AES94629.1| RER1A protein [Medicago truncatula] gi|388500716|gb|AFK38424.1| unknown [Medicago truncatula] Length = 208 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +1 Query: 1 LLFYWIVLLFLTMKRQIMHMVKYRYIPFN 87 LLFYW+VL LTM+RQI HM+KYRY+PFN Sbjct: 158 LLFYWVVLFSLTMRRQISHMIKYRYVPFN 186 >dbj|BAJ87134.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 198 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 1 LLFYWIVLLFLTMKRQIMHMVKYRYIPFNL 90 LL YWIVL LTMKRQI+HMVKY+Y+PFN+ Sbjct: 150 LLCYWIVLFVLTMKRQILHMVKYKYVPFNI 179