BLASTX nr result
ID: Mentha24_contig00014138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00014138 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136036.1| PREDICTED: thiamin pyrophosphokinase 1-like ... 70 3e-10 ref|NP_850424.1| thiamin pyrophosphokinase 2 [Arabidopsis thalia... 70 3e-10 dbj|BAH57065.1| AT2G44750 [Arabidopsis thaliana] 70 3e-10 ref|NP_566026.1| thiamin pyrophosphokinase 2 [Arabidopsis thalia... 70 3e-10 gb|EYU46683.1| hypothetical protein MIMGU_mgv1a012265mg [Mimulus... 69 5e-10 gb|AFK41823.1| unknown [Medicago truncatula] 69 9e-10 ref|XP_003625913.1| Thiamin pyrophosphokinase [Medicago truncatu... 69 9e-10 ref|XP_007163099.1| hypothetical protein PHAVU_001G206100g [Phas... 68 1e-09 gb|AFK45395.1| unknown [Lotus japonicus] 68 1e-09 ref|XP_006359389.1| PREDICTED: thiamine pyrophosphokinase 2-like... 68 2e-09 ref|XP_006359388.1| PREDICTED: thiamine pyrophosphokinase 2-like... 68 2e-09 ref|XP_004247430.1| PREDICTED: thiamin pyrophosphokinase 1-like ... 68 2e-09 ref|XP_006304834.1| hypothetical protein CARUB_v10012506mg, part... 67 2e-09 ref|XP_006285889.1| hypothetical protein CARUB_v10007400mg [Caps... 67 2e-09 ref|NP_849580.1| thiamin pyrophosphokinase1 [Arabidopsis thalian... 67 2e-09 ref|NP_001117219.1| thiamin pyrophosphokinase1 [Arabidopsis thal... 67 2e-09 ref|NP_849579.1| thiamin pyrophosphokinase1 [Arabidopsis thalian... 67 2e-09 ref|NP_563669.1| thiamin pyrophosphokinase1 [Arabidopsis thalian... 67 2e-09 ref|XP_004494369.1| PREDICTED: thiamin pyrophosphokinase 1-like ... 67 3e-09 ref|XP_004290780.1| PREDICTED: thiamin pyrophosphokinase 1-like ... 66 4e-09 >ref|XP_004136036.1| PREDICTED: thiamin pyrophosphokinase 1-like [Cucumis sativus] gi|449498489|ref|XP_004160551.1| PREDICTED: thiamin pyrophosphokinase 1-like [Cucumis sativus] Length = 193 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLK 116 LSDTEM+FGGLISTSN+VKEE VTV+SDSDLLWTISLK Sbjct: 153 LSDTEMKFGGLISTSNIVKEEKVTVQSDSDLLWTISLK 190 >ref|NP_850424.1| thiamin pyrophosphokinase 2 [Arabidopsis thaliana] gi|550600139|sp|F4IV16.1|TPK2_ARATH RecName: Full=Thiamine pyrophosphokinase 2; Short=AtTPK2; AltName: Full=Thiamine kinase 2 gi|330255370|gb|AEC10464.1| thiamin pyrophosphokinase 2 [Arabidopsis thaliana] Length = 267 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQ 119 LS+TEMRFGGLISTSN+VKEEI+TV SDSDLLWTIS+K+ Sbjct: 219 LSNTEMRFGGLISTSNLVKEEIITVESDSDLLWTISIKK 257 >dbj|BAH57065.1| AT2G44750 [Arabidopsis thaliana] Length = 180 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQ 119 LS+TEMRFGGLISTSN+VKEEI+TV SDSDLLWTIS+K+ Sbjct: 132 LSNTEMRFGGLISTSNLVKEEIITVESDSDLLWTISIKK 170 >ref|NP_566026.1| thiamin pyrophosphokinase 2 [Arabidopsis thaliana] gi|14596221|gb|AAK68838.1| putative thiamin pyrophosphokinase [Arabidopsis thaliana] gi|20148329|gb|AAM10055.1| putative thiamin pyrophosphokinase [Arabidopsis thaliana] gi|20197027|gb|AAC27477.2| putative thiamin pyrophosphokinase [Arabidopsis thaliana] gi|330255369|gb|AEC10463.1| thiamin pyrophosphokinase 2 [Arabidopsis thaliana] Length = 265 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQ 119 LS+TEMRFGGLISTSN+VKEEI+TV SDSDLLWTIS+K+ Sbjct: 217 LSNTEMRFGGLISTSNLVKEEIITVESDSDLLWTISIKK 255 >gb|EYU46683.1| hypothetical protein MIMGU_mgv1a012265mg [Mimulus guttatus] Length = 256 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQ 119 LSDTEMRFGGL+STSN+VK EIVTV+SDSDLLWTIS+++ Sbjct: 217 LSDTEMRFGGLVSTSNIVKGEIVTVQSDSDLLWTISIRK 255 >gb|AFK41823.1| unknown [Medicago truncatula] Length = 260 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQI 122 L DTEMRFGGL+STSN+VK +IVTV+SDSDLLWTIS+K++ Sbjct: 221 LKDTEMRFGGLVSTSNIVKGDIVTVQSDSDLLWTISIKKL 260 >ref|XP_003625913.1| Thiamin pyrophosphokinase [Medicago truncatula] gi|357516337|ref|XP_003628457.1| Thiamin pyrophosphokinase [Medicago truncatula] gi|355500928|gb|AES82131.1| Thiamin pyrophosphokinase [Medicago truncatula] gi|355522479|gb|AET02933.1| Thiamin pyrophosphokinase [Medicago truncatula] gi|388502368|gb|AFK39250.1| unknown [Medicago truncatula] Length = 260 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQI 122 L DTEMRFGGL+STSN+VK +IVTV+SDSDLLWTIS+K++ Sbjct: 221 LKDTEMRFGGLVSTSNIVKGDIVTVQSDSDLLWTISIKKL 260 >ref|XP_007163099.1| hypothetical protein PHAVU_001G206100g [Phaseolus vulgaris] gi|561036563|gb|ESW35093.1| hypothetical protein PHAVU_001G206100g [Phaseolus vulgaris] Length = 259 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQI 122 L DT MRFGGLISTSNVVK EIVTV+SDSDLLWTIS+K++ Sbjct: 220 LKDTAMRFGGLISTSNVVKGEIVTVQSDSDLLWTISIKKL 259 >gb|AFK45395.1| unknown [Lotus japonicus] Length = 197 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/40 (72%), Positives = 40/40 (100%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQI 122 L++TEMRFGGL+STSN+VKE+IVTV+SD+DLLWT+S+K++ Sbjct: 158 LNNTEMRFGGLVSTSNIVKEDIVTVQSDTDLLWTVSIKKL 197 >ref|XP_006359389.1| PREDICTED: thiamine pyrophosphokinase 2-like isoform X2 [Solanum tuberosum] Length = 192 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQ 119 L +TEMRFGGL+STSN+VKE IVTV+SDSDLLWTIS+K+ Sbjct: 153 LDNTEMRFGGLVSTSNIVKENIVTVQSDSDLLWTISIKK 191 >ref|XP_006359388.1| PREDICTED: thiamine pyrophosphokinase 2-like isoform X1 [Solanum tuberosum] Length = 279 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQ 119 L +TEMRFGGL+STSN+VKE IVTV+SDSDLLWTIS+K+ Sbjct: 240 LDNTEMRFGGLVSTSNIVKENIVTVQSDSDLLWTISIKK 278 >ref|XP_004247430.1| PREDICTED: thiamin pyrophosphokinase 1-like [Solanum lycopersicum] Length = 256 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQ 119 L +TEMRFGGL+STSN+VKE IVTV+SDSDLLWTIS+K+ Sbjct: 217 LDNTEMRFGGLVSTSNIVKENIVTVQSDSDLLWTISIKK 255 >ref|XP_006304834.1| hypothetical protein CARUB_v10012506mg, partial [Capsella rubella] gi|482573545|gb|EOA37732.1| hypothetical protein CARUB_v10012506mg, partial [Capsella rubella] Length = 318 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQ 119 LS+TEMRFGGLISTSN+VKEE +TV SDSDLLWTIS+K+ Sbjct: 270 LSNTEMRFGGLISTSNLVKEEKITVESDSDLLWTISIKK 308 >ref|XP_006285889.1| hypothetical protein CARUB_v10007400mg [Capsella rubella] gi|482554594|gb|EOA18787.1| hypothetical protein CARUB_v10007400mg [Capsella rubella] Length = 263 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQ 119 LS+TEMRFGGLISTSN+VKEE +TV SDSDLLWTIS+K+ Sbjct: 215 LSNTEMRFGGLISTSNLVKEEKITVESDSDLLWTISIKK 253 >ref|NP_849580.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] gi|550600138|sp|B9DGU7.1|TPK1_ARATH RecName: Full=Thiamine pyrophosphokinase 1; Short=AtTPK1; AltName: Full=Thiamine kinase 1 gi|222424006|dbj|BAH19964.1| AT1G02880 [Arabidopsis thaliana] gi|332189369|gb|AEE27490.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] Length = 267 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQ 119 LS+TEMRFGGLISTSN+VKEE +TV SDSDLLWTIS+K+ Sbjct: 219 LSNTEMRFGGLISTSNLVKEEKITVESDSDLLWTISIKK 257 >ref|NP_001117219.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] gi|332189370|gb|AEE27491.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] Length = 180 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQ 119 LS+TEMRFGGLISTSN+VKEE +TV SDSDLLWTIS+K+ Sbjct: 132 LSNTEMRFGGLISTSNLVKEEKITVESDSDLLWTISIKK 170 >ref|NP_849579.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] gi|16648736|gb|AAL25560.1| At1g02880/F22D16_33 [Arabidopsis thaliana] gi|20856331|gb|AAM26660.1| At1g02880/F22D16_33 [Arabidopsis thaliana] gi|332189367|gb|AEE27488.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] Length = 197 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQ 119 LS+TEMRFGGLISTSN+VKEE +TV SDSDLLWTIS+K+ Sbjct: 149 LSNTEMRFGGLISTSNLVKEEKITVESDSDLLWTISIKK 187 >ref|NP_563669.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] gi|6056414|gb|AAF02878.1|AC009525_12 Unknown protein [Arabidopsis thaliana] gi|21553712|gb|AAM62805.1| thiamin pyrophosphokinase, putative [Arabidopsis thaliana] gi|332189368|gb|AEE27489.1| thiamin pyrophosphokinase1 [Arabidopsis thaliana] Length = 264 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQ 119 LS+TEMRFGGLISTSN+VKEE +TV SDSDLLWTIS+K+ Sbjct: 216 LSNTEMRFGGLISTSNLVKEEKITVESDSDLLWTISIKK 254 >ref|XP_004494369.1| PREDICTED: thiamin pyrophosphokinase 1-like [Cicer arietinum] Length = 263 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/40 (72%), Positives = 39/40 (97%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQI 122 L++TEMRFGGL+STSN+VK +I+TV+SDSDLLWTIS+K++ Sbjct: 224 LNNTEMRFGGLVSTSNIVKGDIITVQSDSDLLWTISIKKL 263 >ref|XP_004290780.1| PREDICTED: thiamin pyrophosphokinase 1-like [Fragaria vesca subsp. vesca] Length = 258 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/40 (72%), Positives = 39/40 (97%) Frame = +3 Query: 3 LSDTEMRFGGLISTSNVVKEEIVTVRSDSDLLWTISLKQI 122 L++TEMRFGGLISTSN+VKE+ +TV+SDSDLLWTI++K++ Sbjct: 219 LNETEMRFGGLISTSNIVKEDKITVQSDSDLLWTITIKKL 258