BLASTX nr result
ID: Mentha24_contig00013667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00013667 (489 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006471485.1| PREDICTED: cytochrome c oxidase assembly pro... 120 1e-25 ref|XP_006432692.1| hypothetical protein CICLE_v100021202mg, par... 120 1e-25 gb|EYU30877.1| hypothetical protein MIMGU_mgv1a010830mg [Mimulus... 119 6e-25 gb|EYU30876.1| hypothetical protein MIMGU_mgv1a010830mg [Mimulus... 119 6e-25 ref|XP_004146871.1| PREDICTED: cytochrome c oxidase assembly pro... 118 7e-25 ref|XP_004306674.1| PREDICTED: cytochrome c oxidase assembly pro... 118 1e-24 ref|XP_007202655.1| hypothetical protein PRUPE_ppa012273mg [Prun... 118 1e-24 gb|EXB62662.1| Cytochrome c oxidase assembly protein COX11 [Moru... 117 2e-24 ref|XP_006418343.1| hypothetical protein EUTSA_v10008363mg [Eutr... 117 2e-24 ref|XP_007015809.1| Cytochrome c oxidase assembly protein CtaG /... 117 2e-24 ref|XP_007015808.1| Cytochrome c oxidase assembly protein CtaG /... 117 2e-24 ref|XP_007015807.1| Cytochrome c oxidase assembly protein CtaG /... 117 2e-24 ref|XP_006305482.1| hypothetical protein CARUB_v10009922mg [Caps... 117 2e-24 gb|AAG00893.1|AC064879_11 Similar to cytochrome-c oxidase assemb... 117 2e-24 ref|NP_171743.1| cytochrome c oxidase assembly protein CtaG / Co... 117 2e-24 ref|XP_003553055.1| PREDICTED: cytochrome c oxidase assembly pro... 117 2e-24 ref|XP_002889401.1| cytochrome c oxidase assembly protein CtaG [... 117 2e-24 ref|XP_007163355.1| hypothetical protein PHAVU_001G227800g [Phas... 117 2e-24 ref|XP_006348705.1| PREDICTED: cytochrome c oxidase assembly pro... 116 3e-24 ref|XP_004239062.1| PREDICTED: cytochrome c oxidase assembly pro... 116 3e-24 >ref|XP_006471485.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like isoform X1 [Citrus sinensis] gi|568834792|ref|XP_006471486.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like isoform X2 [Citrus sinensis] Length = 277 Score = 120 bits (302), Expect = 1e-25 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKVNED Sbjct: 222 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVNED 277 >ref|XP_006432692.1| hypothetical protein CICLE_v100021202mg, partial [Citrus clementina] gi|557534814|gb|ESR45932.1| hypothetical protein CICLE_v100021202mg, partial [Citrus clementina] Length = 119 Score = 120 bits (302), Expect = 1e-25 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKVNED Sbjct: 64 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVNED 119 >gb|EYU30877.1| hypothetical protein MIMGU_mgv1a010830mg [Mimulus guttatus] Length = 292 Score = 119 bits (297), Expect = 6e-25 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNEDK 319 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKM+GINN+ILSYTFFKV+E+K Sbjct: 236 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMEGINNLILSYTFFKVSEEK 292 >gb|EYU30876.1| hypothetical protein MIMGU_mgv1a010830mg [Mimulus guttatus] Length = 300 Score = 119 bits (297), Expect = 6e-25 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNEDK 319 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKM+GINN+ILSYTFFKV+E+K Sbjct: 244 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMEGINNLILSYTFFKVSEEK 300 >ref|XP_004146871.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Cucumis sativus] gi|449521983|ref|XP_004168008.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Cucumis sativus] Length = 333 Score = 118 bits (296), Expect = 7e-25 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN+ILSYTFFKV+E+ Sbjct: 278 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE 333 >ref|XP_004306674.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 266 Score = 118 bits (295), Expect = 1e-24 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINNIILSYTFFKV+E+ Sbjct: 211 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE 266 >ref|XP_007202655.1| hypothetical protein PRUPE_ppa012273mg [Prunus persica] gi|462398186|gb|EMJ03854.1| hypothetical protein PRUPE_ppa012273mg [Prunus persica] Length = 177 Score = 118 bits (295), Expect = 1e-24 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINNIILSYTFFKV+E+ Sbjct: 122 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE 177 >gb|EXB62662.1| Cytochrome c oxidase assembly protein COX11 [Morus notabilis] Length = 282 Score = 117 bits (293), Expect = 2e-24 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 227 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 282 >ref|XP_006418343.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] gi|567156392|ref|XP_006418345.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] gi|557096114|gb|ESQ36696.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] gi|557096116|gb|ESQ36698.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] Length = 291 Score = 117 bits (293), Expect = 2e-24 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 218 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 273 >ref|XP_007015809.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 3 [Theobroma cacao] gi|508786172|gb|EOY33428.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 3 [Theobroma cacao] Length = 279 Score = 117 bits (293), Expect = 2e-24 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 224 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 279 >ref|XP_007015808.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 2 [Theobroma cacao] gi|508786171|gb|EOY33427.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 2 [Theobroma cacao] Length = 269 Score = 117 bits (293), Expect = 2e-24 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 214 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 269 >ref|XP_007015807.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 1 [Theobroma cacao] gi|508786170|gb|EOY33426.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 1 [Theobroma cacao] Length = 278 Score = 117 bits (293), Expect = 2e-24 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 223 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 278 >ref|XP_006305482.1| hypothetical protein CARUB_v10009922mg [Capsella rubella] gi|482574193|gb|EOA38380.1| hypothetical protein CARUB_v10009922mg [Capsella rubella] Length = 287 Score = 117 bits (293), Expect = 2e-24 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 214 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 269 >gb|AAG00893.1|AC064879_11 Similar to cytochrome-c oxidase assembly protein [Arabidopsis thaliana] Length = 216 Score = 117 bits (293), Expect = 2e-24 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 143 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 198 >ref|NP_171743.1| cytochrome c oxidase assembly protein CtaG / Cox11 [Arabidopsis thaliana] gi|75151034|sp|Q8GWR0.1|COX11_ARATH RecName: Full=Cytochrome c oxidase assembly protein COX11, mitochondrial; Flags: Precursor gi|26452392|dbj|BAC43281.1| unknown protein [Arabidopsis thaliana] gi|28950841|gb|AAO63344.1| At1g02410 [Arabidopsis thaliana] gi|332189306|gb|AEE27427.1| cytochrome c oxidase assembly protein CtaG / Cox11 [Arabidopsis thaliana] Length = 287 Score = 117 bits (293), Expect = 2e-24 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 214 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 269 >ref|XP_003553055.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Glycine max] Length = 284 Score = 117 bits (293), Expect = 2e-24 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKM+GINNIILSYTFFKV+E+ Sbjct: 229 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMNGINNIILSYTFFKVSEE 284 >ref|XP_002889401.1| cytochrome c oxidase assembly protein CtaG [Arabidopsis lyrata subsp. lyrata] gi|297335243|gb|EFH65660.1| cytochrome c oxidase assembly protein CtaG [Arabidopsis lyrata subsp. lyrata] Length = 287 Score = 117 bits (293), Expect = 2e-24 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 214 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 269 >ref|XP_007163355.1| hypothetical protein PHAVU_001G227800g [Phaseolus vulgaris] gi|593800638|ref|XP_007163356.1| hypothetical protein PHAVU_001G227800g [Phaseolus vulgaris] gi|561036819|gb|ESW35349.1| hypothetical protein PHAVU_001G227800g [Phaseolus vulgaris] gi|561036820|gb|ESW35350.1| hypothetical protein PHAVU_001G227800g [Phaseolus vulgaris] Length = 268 Score = 117 bits (292), Expect = 2e-24 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 322 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKM+GINNI+LSYTFFKV+E+ Sbjct: 213 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMNGINNIVLSYTFFKVSEE 268 >ref|XP_006348705.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Solanum tuberosum] Length = 287 Score = 116 bits (291), Expect = 3e-24 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNE 325 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN+ILSYTFFKV++ Sbjct: 232 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSD 286 >ref|XP_004239062.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Solanum lycopersicum] Length = 287 Score = 116 bits (291), Expect = 3e-24 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = -1 Query: 489 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNE 325 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN+ILSYTFFKV++ Sbjct: 232 FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSD 286