BLASTX nr result
ID: Mentha24_contig00013660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00013660 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006471485.1| PREDICTED: cytochrome c oxidase assembly pro... 82 1e-13 ref|XP_006432692.1| hypothetical protein CICLE_v100021202mg, par... 82 1e-13 gb|EYU30877.1| hypothetical protein MIMGU_mgv1a010830mg [Mimulus... 80 4e-13 gb|EYU30876.1| hypothetical protein MIMGU_mgv1a010830mg [Mimulus... 80 4e-13 ref|XP_004146871.1| PREDICTED: cytochrome c oxidase assembly pro... 79 5e-13 ref|XP_002463984.1| hypothetical protein SORBIDRAFT_01g010010 [S... 79 5e-13 ref|NP_001170515.1| uncharacterized protein LOC100384526 [Zea ma... 79 5e-13 ref|XP_004306674.1| PREDICTED: cytochrome c oxidase assembly pro... 79 7e-13 ref|XP_007202655.1| hypothetical protein PRUPE_ppa012273mg [Prun... 79 7e-13 gb|EXB62662.1| Cytochrome c oxidase assembly protein COX11 [Moru... 78 1e-12 ref|XP_006418343.1| hypothetical protein EUTSA_v10008363mg [Eutr... 78 1e-12 ref|XP_007015809.1| Cytochrome c oxidase assembly protein CtaG /... 78 1e-12 ref|XP_007015808.1| Cytochrome c oxidase assembly protein CtaG /... 78 1e-12 ref|XP_007015807.1| Cytochrome c oxidase assembly protein CtaG /... 78 1e-12 ref|XP_006305482.1| hypothetical protein CARUB_v10009922mg [Caps... 78 1e-12 gb|EMT15700.1| Cytochrome c oxidase assembly protein ctaG [Aegil... 78 1e-12 gb|AAG00893.1|AC064879_11 Similar to cytochrome-c oxidase assemb... 78 1e-12 ref|NP_171743.1| cytochrome c oxidase assembly protein CtaG / Co... 78 1e-12 ref|XP_003560576.1| PREDICTED: cytochrome c oxidase assembly pro... 78 1e-12 ref|XP_003553055.1| PREDICTED: cytochrome c oxidase assembly pro... 78 1e-12 >ref|XP_006471485.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like isoform X1 [Citrus sinensis] gi|568834792|ref|XP_006471486.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like isoform X2 [Citrus sinensis] Length = 277 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 226 QIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKVNED Sbjct: 240 QIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVNED 277 >ref|XP_006432692.1| hypothetical protein CICLE_v100021202mg, partial [Citrus clementina] gi|557534814|gb|ESR45932.1| hypothetical protein CICLE_v100021202mg, partial [Citrus clementina] Length = 119 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 226 QIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKVNED Sbjct: 82 QIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVNED 119 >gb|EYU30877.1| hypothetical protein MIMGU_mgv1a010830mg [Mimulus guttatus] Length = 292 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNEDK 223 QIDMPVFFYIDPEFETDPKM+GINN+ILSYTFFKV+E+K Sbjct: 254 QIDMPVFFYIDPEFETDPKMEGINNLILSYTFFKVSEEK 292 >gb|EYU30876.1| hypothetical protein MIMGU_mgv1a010830mg [Mimulus guttatus] Length = 300 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNEDK 223 QIDMPVFFYIDPEFETDPKM+GINN+ILSYTFFKV+E+K Sbjct: 262 QIDMPVFFYIDPEFETDPKMEGINNLILSYTFFKVSEEK 300 >ref|XP_004146871.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Cucumis sativus] gi|449521983|ref|XP_004168008.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Cucumis sativus] Length = 333 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 226 QIDMPVFFYIDPEFETDPKMDGINN+ILSYTFFKV+E+ Sbjct: 296 QIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE 333 >ref|XP_002463984.1| hypothetical protein SORBIDRAFT_01g010010 [Sorghum bicolor] gi|241917838|gb|EER90982.1| hypothetical protein SORBIDRAFT_01g010010 [Sorghum bicolor] Length = 237 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNE 229 QIDMPVFFYIDPEFETDPKMDG+NNI+LSYTFFKVN+ Sbjct: 200 QIDMPVFFYIDPEFETDPKMDGVNNIVLSYTFFKVND 236 >ref|NP_001170515.1| uncharacterized protein LOC100384526 [Zea mays] gi|195621262|gb|ACG32461.1| cytochrome c oxidase assembly protein ctaG [Zea mays] gi|238005800|gb|ACR33935.1| unknown [Zea mays] gi|414872495|tpg|DAA51052.1| TPA: cytochrome c oxidase assembly protein ctaG [Zea mays] Length = 233 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNE 229 QIDMPVFFYIDPEFETDPKMDG+NNI+LSYTFFKVN+ Sbjct: 196 QIDMPVFFYIDPEFETDPKMDGVNNIVLSYTFFKVND 232 >ref|XP_004306674.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 266 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 226 QIDMPVFFYIDPEFETDP+MDGINNIILSYTFFKV+E+ Sbjct: 229 QIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE 266 >ref|XP_007202655.1| hypothetical protein PRUPE_ppa012273mg [Prunus persica] gi|462398186|gb|EMJ03854.1| hypothetical protein PRUPE_ppa012273mg [Prunus persica] Length = 177 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 226 QIDMPVFFYIDPEFETDP+MDGINNIILSYTFFKV+E+ Sbjct: 140 QIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE 177 >gb|EXB62662.1| Cytochrome c oxidase assembly protein COX11 [Morus notabilis] Length = 282 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 226 QIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 245 QIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 282 >ref|XP_006418343.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] gi|567156392|ref|XP_006418345.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] gi|557096114|gb|ESQ36696.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] gi|557096116|gb|ESQ36698.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] Length = 291 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 226 QIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 236 QIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 273 >ref|XP_007015809.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 3 [Theobroma cacao] gi|508786172|gb|EOY33428.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 3 [Theobroma cacao] Length = 279 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 226 QIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 242 QIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 279 >ref|XP_007015808.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 2 [Theobroma cacao] gi|508786171|gb|EOY33427.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 2 [Theobroma cacao] Length = 269 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 226 QIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 232 QIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 269 >ref|XP_007015807.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 1 [Theobroma cacao] gi|508786170|gb|EOY33426.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 1 [Theobroma cacao] Length = 278 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 226 QIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 241 QIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 278 >ref|XP_006305482.1| hypothetical protein CARUB_v10009922mg [Capsella rubella] gi|482574193|gb|EOA38380.1| hypothetical protein CARUB_v10009922mg [Capsella rubella] Length = 287 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 226 QIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 232 QIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 269 >gb|EMT15700.1| Cytochrome c oxidase assembly protein ctaG [Aegilops tauschii] Length = 234 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNE 229 QIDMPVFFYIDPEFETDPKMDG+NNI+LSYTFFKV E Sbjct: 198 QIDMPVFFYIDPEFETDPKMDGVNNIVLSYTFFKVKE 234 >gb|AAG00893.1|AC064879_11 Similar to cytochrome-c oxidase assembly protein [Arabidopsis thaliana] Length = 216 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 226 QIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 161 QIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 198 >ref|NP_171743.1| cytochrome c oxidase assembly protein CtaG / Cox11 [Arabidopsis thaliana] gi|75151034|sp|Q8GWR0.1|COX11_ARATH RecName: Full=Cytochrome c oxidase assembly protein COX11, mitochondrial; Flags: Precursor gi|26452392|dbj|BAC43281.1| unknown protein [Arabidopsis thaliana] gi|28950841|gb|AAO63344.1| At1g02410 [Arabidopsis thaliana] gi|332189306|gb|AEE27427.1| cytochrome c oxidase assembly protein CtaG / Cox11 [Arabidopsis thaliana] Length = 287 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 226 QIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+E+ Sbjct: 232 QIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 269 >ref|XP_003560576.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Brachypodium distachyon] Length = 233 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNE 229 QIDMPVFFYIDPEFETDPKMDG+NNI+LSYTFFKV E Sbjct: 197 QIDMPVFFYIDPEFETDPKMDGVNNIVLSYTFFKVKE 233 >ref|XP_003553055.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Glycine max] Length = 284 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 339 QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 226 QIDMPVFFYIDPEFETDPKM+GINNIILSYTFFKV+E+ Sbjct: 247 QIDMPVFFYIDPEFETDPKMNGINNIILSYTFFKVSEE 284