BLASTX nr result
ID: Mentha24_contig00013529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00013529 (834 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20278.1| hypothetical protein MIMGU_mgv1a004956mg [Mimulus... 61 5e-07 >gb|EYU20278.1| hypothetical protein MIMGU_mgv1a004956mg [Mimulus guttatus] Length = 503 Score = 61.2 bits (147), Expect = 5e-07 Identities = 32/58 (55%), Positives = 41/58 (70%) Frame = +1 Query: 655 MNFSAKGASIVTKKLNAEATLNPNAAKFVPFALRSQAASVTTAEISPKFVEKSVLEIS 828 MNFSAKG S K ATLNPNA +FVP A+RSQ+A++T ++ S KF KS+L+ S Sbjct: 1 MNFSAKGGSSAAK-----ATLNPNAVEFVPSAIRSQSAAITISDTSSKFASKSILDRS 53