BLASTX nr result
ID: Mentha24_contig00013491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00013491 (302 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20978.1| hypothetical protein MIMGU_mgv1a022212mg, partial... 77 3e-12 gb|EYU29777.1| hypothetical protein MIMGU_mgv1a008457mg [Mimulus... 73 4e-11 gb|EYU41842.1| hypothetical protein MIMGU_mgv1a020578mg [Mimulus... 69 5e-10 gb|EYU41900.1| hypothetical protein MIMGU_mgv11b022084mg, partia... 68 1e-09 gb|EYU38949.1| hypothetical protein MIMGU_mgv1a024102mg [Mimulus... 67 2e-09 gb|EYU41913.1| hypothetical protein MIMGU_mgv11b024393mg [Mimulu... 65 8e-09 gb|EYU35246.1| hypothetical protein MIMGU_mgv1a006037mg [Mimulus... 65 8e-09 gb|EYU41783.1| hypothetical protein MIMGU_mgv1a010050mg [Mimulus... 65 1e-08 gb|EYU27057.1| hypothetical protein MIMGU_mgv1a009397mg [Mimulus... 65 1e-08 gb|EYU41852.1| hypothetical protein MIMGU_mgv1a020064mg, partial... 65 1e-08 gb|EYU36072.1| hypothetical protein MIMGU_mgv1a019763mg, partial... 65 1e-08 gb|EYU18113.1| hypothetical protein MIMGU_mgv1a024785mg, partial... 65 1e-08 gb|EYU41846.1| hypothetical protein MIMGU_mgv1a020181mg, partial... 64 2e-08 gb|EYU27335.1| hypothetical protein MIMGU_mgv1a017041mg [Mimulus... 64 2e-08 gb|EYU24345.1| hypothetical protein MIMGU_mgv11b005010mg [Mimulu... 64 2e-08 gb|EYU41849.1| hypothetical protein MIMGU_mgv1a005853mg [Mimulus... 64 3e-08 gb|EYU25811.1| hypothetical protein MIMGU_mgv11b018114mg [Mimulu... 64 3e-08 gb|EYU41072.1| hypothetical protein MIMGU_mgv1a023916mg, partial... 63 4e-08 gb|EYU23721.1| hypothetical protein MIMGU_mgv1a019171mg, partial... 62 6e-08 gb|EYU41070.1| hypothetical protein MIMGU_mgv1a017941mg, partial... 61 1e-07 >gb|EYU20978.1| hypothetical protein MIMGU_mgv1a022212mg, partial [Mimulus guttatus] Length = 241 Score = 76.6 bits (187), Expect = 3e-12 Identities = 41/86 (47%), Positives = 55/86 (63%) Frame = -3 Query: 261 FKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSKLMLKRLEVYFH 82 FKPLK L L + V G A++ LR+CP LE L + + S VE+CGS L+LKRLE+ + Sbjct: 108 FKPLKALTLEYIDVDGGAIEFFLRNCPLLEELIVHESKELSIVEVCGSSLVLKRLEICYC 167 Query: 81 RGNRFLKVSAPNLNWLKVDSSSENLL 4 R + ++VSAPNL L V S E L+ Sbjct: 168 RNLKLVRVSAPNLVSLTVQSLEELLI 193 >gb|EYU29777.1| hypothetical protein MIMGU_mgv1a008457mg [Mimulus guttatus] Length = 373 Score = 73.2 bits (178), Expect = 4e-11 Identities = 39/86 (45%), Positives = 54/86 (62%) Frame = -3 Query: 261 FKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSKLMLKRLEVYFH 82 FKPLK L L V+ EA++ L +CP LE L + + S+VE+CGS L+LKRLE+ + Sbjct: 98 FKPLKALTLKFIDVNDEAIEFFLLNCPLLEELIVHESKELSNVEVCGSSLVLKRLEICYC 157 Query: 81 RGNRFLKVSAPNLNWLKVDSSSENLL 4 R + ++VSAPNL L V E +L Sbjct: 158 RNLKLVRVSAPNLVSLTVQELEELIL 183 >gb|EYU41842.1| hypothetical protein MIMGU_mgv1a020578mg [Mimulus guttatus] Length = 532 Score = 69.3 bits (168), Expect = 5e-10 Identities = 40/97 (41%), Positives = 56/97 (57%) Frame = -3 Query: 294 SGLCRPQNLILFKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSK 115 + + P + I FK LK L + VSGEA++ LR+CP LE L + +A S++E+CGS Sbjct: 369 ASILEPASCIDFKSLKALSMRFVNVSGEAIEFFLRTCPFLEKLVVHNASELSNLEVCGSS 428 Query: 114 LMLKRLEVYFHRGNRFLKVSAPNLNWLKVDSSSENLL 4 L LK LE+ +KVSAPNL L + + LL Sbjct: 429 LDLKHLELQSCHNLTSIKVSAPNLTSLTLPNVKGLLL 465 >gb|EYU41900.1| hypothetical protein MIMGU_mgv11b022084mg, partial [Mimulus guttatus] Length = 448 Score = 68.2 bits (165), Expect = 1e-09 Identities = 40/93 (43%), Positives = 56/93 (60%) Frame = -3 Query: 279 PQNLILFKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSKLMLKR 100 P+ L+ FK LK L +V A++ L +CP LE L + + S +E+CGS L LK Sbjct: 166 PRMLVDFKSLKELSFRSVQVGDAAIEFFLHNCPLLEKLIVHHSEKISKLEVCGSSLKLKH 225 Query: 99 LEVYFHRGNRFLKVSAPNLNWLKVDSSSENLLL 1 LE+ + G + LKVSAP+L LKV +S + LLL Sbjct: 226 LEIVYCFGLKSLKVSAPSLTSLKV-TSLDGLLL 257 >gb|EYU38949.1| hypothetical protein MIMGU_mgv1a024102mg [Mimulus guttatus] Length = 469 Score = 67.4 bits (163), Expect = 2e-09 Identities = 40/89 (44%), Positives = 54/89 (60%) Frame = -3 Query: 267 ILFKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSKLMLKRLEVY 88 I F+ LK LC VSGEA++ LR CP LE L + +A S++E+CGS L LK L++ Sbjct: 197 INFRSLKELCFKCVTVSGEAIEFFLRKCPLLEKLVVQNASQISNLEVCGSSLALKHLKLK 256 Query: 87 FHRGNRFLKVSAPNLNWLKVDSSSENLLL 1 + +KVSAPNL L + +E LLL Sbjct: 257 SCYDLKSVKVSAPNLASLSI-LDAEGLLL 284 >gb|EYU41913.1| hypothetical protein MIMGU_mgv11b024393mg [Mimulus guttatus] Length = 464 Score = 65.5 bits (158), Expect = 8e-09 Identities = 39/91 (42%), Positives = 49/91 (53%) Frame = -3 Query: 300 RESGLCRPQNLILFKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICG 121 RE L P+ L F LK L VS A++L L +CP LE L + + S +E+CG Sbjct: 169 REPKLQHPRMLFDFTSLKELSFKSIIVSDRAIELFLHNCPLLEQLIVHYSQKISKLEVCG 228 Query: 120 SKLMLKRLEVYFHRGNRFLKVSAPNLNWLKV 28 LMLK LE+ G + LKVSAP L L V Sbjct: 229 PSLMLKHLEIVHCTGLKSLKVSAPRLTTLNV 259 >gb|EYU35246.1| hypothetical protein MIMGU_mgv1a006037mg [Mimulus guttatus] Length = 460 Score = 65.5 bits (158), Expect = 8e-09 Identities = 37/77 (48%), Positives = 48/77 (62%) Frame = -3 Query: 261 FKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSKLMLKRLEVYFH 82 FK LK L LN VS EA++ LR+CP LE L++ + S++E+ GS L+LK LE+ Sbjct: 179 FKSLKALSLNRVNVSSEAIEFFLRNCPLLEQLTVHNEKELSNLEVWGSSLVLKHLEITDC 238 Query: 81 RGNRFLKVSAPNLNWLK 31 R LKVSAPNL K Sbjct: 239 DKLRSLKVSAPNLTSFK 255 >gb|EYU41783.1| hypothetical protein MIMGU_mgv1a010050mg [Mimulus guttatus] Length = 324 Score = 65.1 bits (157), Expect = 1e-08 Identities = 36/87 (41%), Positives = 54/87 (62%) Frame = -3 Query: 261 FKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSKLMLKRLEVYFH 82 FK LK L L V+G+A++++LR CP LE L + S++E+CG L+LK E+ + Sbjct: 151 FKSLKELSLKCLNVTGQAIEILLRMCPLLEKLVVHRTTKISNLEVCGPSLVLKHFELVYC 210 Query: 81 RGNRFLKVSAPNLNWLKVDSSSENLLL 1 G +KVSAPNL L + +++ LLL Sbjct: 211 FGLESVKVSAPNLISL-IGLNADGLLL 236 >gb|EYU27057.1| hypothetical protein MIMGU_mgv1a009397mg [Mimulus guttatus] Length = 343 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/82 (37%), Positives = 52/82 (63%) Frame = -3 Query: 261 FKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSKLMLKRLEVYFH 82 F PLK L L + V G A++ LR+CP LE L++ + SDV +CG+ L+LK LE+ + Sbjct: 179 FTPLKALTLKYIDVDGGAIEFFLRNCPLLEELTVHESKELSDVSVCGTSLVLKHLEICYC 238 Query: 81 RGNRFLKVSAPNLNWLKVDSSS 16 R + +++ +P+++ LK S+ Sbjct: 239 RDLKCVRLHSPSISTLKSTMST 260 >gb|EYU41852.1| hypothetical protein MIMGU_mgv1a020064mg, partial [Mimulus guttatus] Length = 367 Score = 64.7 bits (156), Expect = 1e-08 Identities = 41/89 (46%), Positives = 53/89 (59%) Frame = -3 Query: 267 ILFKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSKLMLKRLEVY 88 I FK LK L L V+GEA++ LR+CPSLE L + S++E+CG L LK L++ Sbjct: 175 INFKSLKALSLKCVNVTGEAIEFFLRNCPSLEKLVVTYTSKLSNLEVCGPSLALKHLDLR 234 Query: 87 FHRGNRFLKVSAPNLNWLKVDSSSENLLL 1 F + +KVSAPNL L V E LLL Sbjct: 235 FCFRLKSVKVSAPNLISLTV-PKVEGLLL 262 >gb|EYU36072.1| hypothetical protein MIMGU_mgv1a019763mg, partial [Mimulus guttatus] Length = 357 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/73 (45%), Positives = 47/73 (64%) Frame = -3 Query: 261 FKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSKLMLKRLEVYFH 82 FK LK L L K+SGEA++ LR+CP LE L + + S++E+CG L LK LE++F Sbjct: 178 FKSLKALSLKCVKLSGEAIEFFLRNCPFLEKLVLRNVNGISNLEVCGPSLALKHLEIWFC 237 Query: 81 RGNRFLKVSAPNL 43 + ++VS PNL Sbjct: 238 AKLKSVRVSGPNL 250 >gb|EYU18113.1| hypothetical protein MIMGU_mgv1a024785mg, partial [Mimulus guttatus] Length = 409 Score = 64.7 bits (156), Expect = 1e-08 Identities = 40/95 (42%), Positives = 56/95 (58%), Gaps = 1/95 (1%) Frame = -3 Query: 282 RPQNLILFKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIG-SAVFTSDVEICGSKLML 106 R L FK LK L VSG A++ +LR+CP LE L + S TS +E+CGS L+L Sbjct: 121 RSSTLSEFKSLKSLSFKGVNVSGRAIEFLLRNCPRLEQLIVSHSQDKTSKIEVCGSSLVL 180 Query: 105 KRLEVYFHRGNRFLKVSAPNLNWLKVDSSSENLLL 1 K L++ + LK+SAP+L L + +S E +LL Sbjct: 181 KHLKIAYCSALESLKISAPSLTSLGL-TSLEGVLL 214 >gb|EYU41846.1| hypothetical protein MIMGU_mgv1a020181mg, partial [Mimulus guttatus] Length = 400 Score = 64.3 bits (155), Expect = 2e-08 Identities = 37/92 (40%), Positives = 54/92 (58%) Frame = -3 Query: 279 PQNLILFKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSKLMLKR 100 P+ FK LK L L V+ EA++ L +CP LE L + +++EICGS L+LK Sbjct: 176 PRTRFDFKHLKALSLKFVTVTREAIEFFLNNCPLLEKLVVHKITKITNLEICGSSLVLKH 235 Query: 99 LEVYFHRGNRFLKVSAPNLNWLKVDSSSENLL 4 LE+++ +KVSAPNL L V+ +E +L Sbjct: 236 LELWYCFDLDSVKVSAPNLTSLSVNLFNELIL 267 >gb|EYU27335.1| hypothetical protein MIMGU_mgv1a017041mg [Mimulus guttatus] Length = 96 Score = 63.9 bits (154), Expect = 2e-08 Identities = 36/79 (45%), Positives = 47/79 (59%) Frame = -3 Query: 279 PQNLILFKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSKLMLKR 100 P+ L FK LK L L +VS A++ L +CP LE L + ++ S +EICGS L LK Sbjct: 14 PRMLFDFKSLKALSLKSVRVSDGAIEFFLHNCPLLEQLIVHESIKLSRLEICGSSLKLKH 73 Query: 99 LEVYFHRGNRFLKVSAPNL 43 LE+ R + LKVSAP L Sbjct: 74 LEIVSCRRLKSLKVSAPRL 92 >gb|EYU24345.1| hypothetical protein MIMGU_mgv11b005010mg [Mimulus guttatus] Length = 457 Score = 63.9 bits (154), Expect = 2e-08 Identities = 36/90 (40%), Positives = 53/90 (58%), Gaps = 4/90 (4%) Frame = -3 Query: 270 LILFKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICG----SKLMLK 103 +I FK L+ L +H VS A++ LR+CP LE L + + S+ +CG S L+LK Sbjct: 176 IINFKSLRELIFSHVDVSDGAIEFFLRNCPLLEKLIVCHSTELSNPRVCGGGGSSPLVLK 235 Query: 102 RLEVYFHRGNRFLKVSAPNLNWLKVDSSSE 13 LE+ F G + LKVSAP+L ++K + E Sbjct: 236 HLEIVFCNGLKSLKVSAPSLTYVKAATYEE 265 >gb|EYU41849.1| hypothetical protein MIMGU_mgv1a005853mg [Mimulus guttatus] Length = 467 Score = 63.5 bits (153), Expect = 3e-08 Identities = 36/88 (40%), Positives = 51/88 (57%) Frame = -3 Query: 279 PQNLILFKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSKLMLKR 100 P+ FK LK L L V+ EA++ L +CP LE L + +++EICGS L+LK Sbjct: 233 PRTRFDFKHLKALSLKFVTVTREAIEFFLNNCPLLEKLVVHKITKITNLEICGSSLVLKH 292 Query: 99 LEVYFHRGNRFLKVSAPNLNWLKVDSSS 16 LE+++ +KVSAPNL L V S+ Sbjct: 293 LELWYCFDLDSVKVSAPNLTSLSVKGST 320 >gb|EYU25811.1| hypothetical protein MIMGU_mgv11b018114mg [Mimulus guttatus] Length = 421 Score = 63.5 bits (153), Expect = 3e-08 Identities = 36/87 (41%), Positives = 50/87 (57%) Frame = -3 Query: 282 RPQNLILFKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSKLMLK 103 R ++ FK LK L L + G ++L LR+CP LE L + +A +E+CG L+LK Sbjct: 130 RSNTVLEFKSLKALSLKRVTLRGGEIELFLRNCPLLEQLIVHTAWNIPTIEVCGPSLVLK 189 Query: 102 RLEVYFHRGNRFLKVSAPNLNWLKVDS 22 LE+ G + LKV APNL L+V S Sbjct: 190 HLEIVNCTGLQSLKVYAPNLASLRVTS 216 >gb|EYU41072.1| hypothetical protein MIMGU_mgv1a023916mg, partial [Mimulus guttatus] Length = 252 Score = 63.2 bits (152), Expect = 4e-08 Identities = 37/85 (43%), Positives = 49/85 (57%), Gaps = 1/85 (1%) Frame = -3 Query: 273 NLIL-FKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSKLMLKRL 97 N++L FK LK L L + G ++L LR+CP LE L + + S +E+CG L+LK L Sbjct: 152 NMVLGFKSLKELSLKKVNLRGGDIELFLRNCPLLEQLIVHTTWTVSKIEVCGPSLVLKHL 211 Query: 96 EVYFHRGNRFLKVSAPNLNWLKVDS 22 E+ G LKV APNL L V S Sbjct: 212 EIVKCTGLESLKVYAPNLASLSVTS 236 >gb|EYU23721.1| hypothetical protein MIMGU_mgv1a019171mg, partial [Mimulus guttatus] Length = 442 Score = 62.4 bits (150), Expect = 6e-08 Identities = 38/87 (43%), Positives = 50/87 (57%) Frame = -3 Query: 261 FKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGSAVFTSDVEICGSKLMLKRLEVYFH 82 F+ LK L L V+ EAV+ L +CP LE L + S++E+CGS L LK LE+ Sbjct: 163 FRSLKELSLKSVIVTREAVEFFLHNCPLLEKLVVSYTCQLSNLEVCGSSLALKHLELKHC 222 Query: 81 RGNRFLKVSAPNLNWLKVDSSSENLLL 1 G + +KVSAPNL L + E LLL Sbjct: 223 YGLKSVKVSAPNLTSLSI-PKVEGLLL 248 >gb|EYU41070.1| hypothetical protein MIMGU_mgv1a017941mg, partial [Mimulus guttatus] Length = 265 Score = 61.2 bits (147), Expect = 1e-07 Identities = 36/93 (38%), Positives = 52/93 (55%), Gaps = 1/93 (1%) Frame = -3 Query: 297 ESGLCRPQNLILFKPLKRLCLNHFKVSGEAVKLILRSCPSLEVLSIGS-AVFTSDVEICG 121 E L R ++ F LK L L + ++SG A++ + +C LE L + S S +E+CG Sbjct: 159 EQLLARSNMILNFNSLKELSLKNVQLSGGAIEFFIHNCTRLEKLIVDSPGENVSKLEVCG 218 Query: 120 SKLMLKRLEVYFHRGNRFLKVSAPNLNWLKVDS 22 S L+LK LE+ G LK+SAP L L+V S Sbjct: 219 SSLVLKHLEIVSFVGLESLKISAPRLTSLRVTS 251