BLASTX nr result
ID: Mentha24_contig00013216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00013216 (482 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39805.1| hypothetical protein MIMGU_mgv1a002856mg [Mimulus... 70 4e-10 gb|EYU39572.1| hypothetical protein MIMGU_mgv1a001895mg [Mimulus... 61 2e-07 >gb|EYU39805.1| hypothetical protein MIMGU_mgv1a002856mg [Mimulus guttatus] Length = 630 Score = 69.7 bits (169), Expect = 4e-10 Identities = 36/72 (50%), Positives = 51/72 (70%), Gaps = 8/72 (11%) Frame = -2 Query: 481 QPSPRSTKQNIHDHSPEIQTRKTSLLSRWRDRNK-------DSNDEKLPNE-GQNITVKH 326 Q SPRS +Q+ DHS E+ TRK SLLSRWRD+NK + N+ K NE +++++++ Sbjct: 559 QSSPRSVQQSDQDHSQEMPTRKISLLSRWRDKNKEKSSGVEEQNEGKSSNEDNRSLSLEN 618 Query: 325 DETNGHEVHEKV 290 +ETNGH+V EKV Sbjct: 619 EETNGHKVDEKV 630 >gb|EYU39572.1| hypothetical protein MIMGU_mgv1a001895mg [Mimulus guttatus] Length = 743 Score = 60.8 bits (146), Expect = 2e-07 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 14/77 (18%) Frame = -2 Query: 481 QPSPRSTKQNIHDHSPEI-QTRKTSLLSR-----WRDRNK--------DSNDEKLPNEGQ 344 QPSPRS +QN + S +I RK SLLSR WRDRNK +N + NEG+ Sbjct: 666 QPSPRSVQQNNQESSQDIIPPRKISLLSRPFGLGWRDRNKGKPVIVEEQTNGKSSSNEGE 725 Query: 343 NITVKHDETNGHEVHEK 293 +++K +E+NGH+V EK Sbjct: 726 KLSLKQEESNGHQVEEK 742