BLASTX nr result
ID: Mentha24_contig00013181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00013181 (585 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB44290.1| hypothetical protein L484_012209 [Morus notabilis] 69 1e-09 ref|XP_002303964.2| ran-binding family protein [Populus trichoca... 69 1e-09 ref|XP_007010637.1| ARM repeat superfamily protein [Theobroma ca... 69 1e-09 ref|XP_007218912.1| hypothetical protein PRUPE_ppa000653mg [Prun... 69 1e-09 ref|XP_002299168.1| ran-binding family protein [Populus trichoca... 69 1e-09 ref|XP_004306463.1| PREDICTED: exportin-7-like [Fragaria vesca s... 67 3e-09 ref|XP_002525573.1| Exportin-7, putative [Ricinus communis] gi|2... 67 3e-09 ref|XP_006471264.1| PREDICTED: exportin-7-like [Citrus sinensis] 67 5e-09 ref|XP_006432319.1| hypothetical protein CICLE_v100001492mg, par... 67 5e-09 ref|XP_007220322.1| hypothetical protein PRUPE_ppa001153m1g, par... 67 5e-09 ref|XP_003634876.1| PREDICTED: exportin-7-like [Vitis vinifera] ... 66 6e-09 ref|XP_004501105.1| PREDICTED: exportin-7-B-like, partial [Cicer... 65 1e-08 ref|XP_004164991.1| PREDICTED: exportin-7-B-like [Cucumis sativus] 65 2e-08 ref|XP_004146773.1| PREDICTED: LOW QUALITY PROTEIN: exportin-7-l... 65 2e-08 gb|EYU26917.1| hypothetical protein MIMGU_mgv1a000594mg [Mimulus... 64 2e-08 gb|AEW08903.1| hypothetical protein CL2191Contig1_03, partial [P... 64 2e-08 ref|XP_001772700.1| predicted protein [Physcomitrella patens] gi... 64 3e-08 ref|XP_001784686.1| predicted protein [Physcomitrella patens] gi... 64 3e-08 ref|XP_007137339.1| hypothetical protein PHAVU_009G118700g [Phas... 64 4e-08 ref|XP_006577895.1| PREDICTED: exportin-7-B-like isoform X3 [Gly... 63 5e-08 >gb|EXB44290.1| hypothetical protein L484_012209 [Morus notabilis] Length = 943 Score = 68.6 bits (166), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+TRSLDSKNRDKFTQNLTVFRH+FRVK Sbjct: 910 FDKLMADVTRSLDSKNRDKFTQNLTVFRHEFRVK 943 >ref|XP_002303964.2| ran-binding family protein [Populus trichocarpa] gi|550343499|gb|EEE78943.2| ran-binding family protein [Populus trichocarpa] Length = 1049 Score = 68.6 bits (166), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+TRSLDSKNRDKFTQNLTVFRH+FRVK Sbjct: 1016 FDKLMADVTRSLDSKNRDKFTQNLTVFRHEFRVK 1049 >ref|XP_007010637.1| ARM repeat superfamily protein [Theobroma cacao] gi|508727550|gb|EOY19447.1| ARM repeat superfamily protein [Theobroma cacao] Length = 1151 Score = 68.6 bits (166), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+TRSLDSKNRDKFTQNLTVFRH+FRVK Sbjct: 1019 FDKLMTDVTRSLDSKNRDKFTQNLTVFRHEFRVK 1052 >ref|XP_007218912.1| hypothetical protein PRUPE_ppa000653mg [Prunus persica] gi|462415374|gb|EMJ20111.1| hypothetical protein PRUPE_ppa000653mg [Prunus persica] Length = 1051 Score = 68.6 bits (166), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+TRSLDSKNRDKFTQNLTVFRH+FRVK Sbjct: 1018 FDKLMADVTRSLDSKNRDKFTQNLTVFRHEFRVK 1051 >ref|XP_002299168.1| ran-binding family protein [Populus trichocarpa] gi|222846426|gb|EEE83973.1| ran-binding family protein [Populus trichocarpa] Length = 1049 Score = 68.6 bits (166), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+TRSLDSKNRDKFTQNLTVFRH+FRVK Sbjct: 1016 FDKLMADVTRSLDSKNRDKFTQNLTVFRHEFRVK 1049 >ref|XP_004306463.1| PREDICTED: exportin-7-like [Fragaria vesca subsp. vesca] Length = 1052 Score = 67.4 bits (163), Expect = 3e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+TRSLDSKNRDKFTQNLTVFR+DFRVK Sbjct: 1019 FDKLMADVTRSLDSKNRDKFTQNLTVFRNDFRVK 1052 >ref|XP_002525573.1| Exportin-7, putative [Ricinus communis] gi|223535152|gb|EEF36832.1| Exportin-7, putative [Ricinus communis] Length = 1089 Score = 67.4 bits (163), Expect = 3e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+TRSLDSKNRD+FTQNLTVFRH+FRVK Sbjct: 1019 FDKLMADVTRSLDSKNRDRFTQNLTVFRHEFRVK 1052 >ref|XP_006471264.1| PREDICTED: exportin-7-like [Citrus sinensis] Length = 1052 Score = 66.6 bits (161), Expect = 5e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+ RSLDSKNRDKFTQNLTVFRH+FRVK Sbjct: 1019 FDKLMADVARSLDSKNRDKFTQNLTVFRHEFRVK 1052 >ref|XP_006432319.1| hypothetical protein CICLE_v100001492mg, partial [Citrus clementina] gi|557534441|gb|ESR45559.1| hypothetical protein CICLE_v100001492mg, partial [Citrus clementina] Length = 895 Score = 66.6 bits (161), Expect = 5e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+ RSLDSKNRDKFTQNLTVFRH+FRVK Sbjct: 862 FDKLMADVARSLDSKNRDKFTQNLTVFRHEFRVK 895 >ref|XP_007220322.1| hypothetical protein PRUPE_ppa001153m1g, partial [Prunus persica] gi|462416784|gb|EMJ21521.1| hypothetical protein PRUPE_ppa001153m1g, partial [Prunus persica] Length = 788 Score = 66.6 bits (161), Expect = 5e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+TRSLDSKNRDKFTQNLTVFRH+F VK Sbjct: 755 FDKLMADVTRSLDSKNRDKFTQNLTVFRHEFHVK 788 >ref|XP_003634876.1| PREDICTED: exportin-7-like [Vitis vinifera] gi|298205126|emb|CBI40647.3| unnamed protein product [Vitis vinifera] Length = 1052 Score = 66.2 bits (160), Expect = 6e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+ RSLDSKNRDKFTQNLT+FRH+FRVK Sbjct: 1019 FDKLMADVNRSLDSKNRDKFTQNLTIFRHEFRVK 1052 >ref|XP_004501105.1| PREDICTED: exportin-7-B-like, partial [Cicer arietinum] Length = 1079 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+T S+DSKNRDKFTQNLTVFRHDFR K Sbjct: 1046 FDKLMADVTLSIDSKNRDKFTQNLTVFRHDFRAK 1079 >ref|XP_004164991.1| PREDICTED: exportin-7-B-like [Cucumis sativus] Length = 789 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 F+KLM D+TRSLDSKN+DKFTQNLTVFRH+FR+K Sbjct: 756 FEKLMADVTRSLDSKNKDKFTQNLTVFRHEFRLK 789 >ref|XP_004146773.1| PREDICTED: LOW QUALITY PROTEIN: exportin-7-like [Cucumis sativus] Length = 1061 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 F+KLM D+TRSLDSKN+DKFTQNLTVFRH+FR+K Sbjct: 1028 FEKLMADVTRSLDSKNKDKFTQNLTVFRHEFRLK 1061 >gb|EYU26917.1| hypothetical protein MIMGU_mgv1a000594mg [Mimulus guttatus] Length = 1052 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM DI RS D KNRDKFTQNLT+FRHDFRVK Sbjct: 1019 FDKLMADINRSTDPKNRDKFTQNLTIFRHDFRVK 1052 >gb|AEW08903.1| hypothetical protein CL2191Contig1_03, partial [Pinus radiata] gi|383171901|gb|AFG69308.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171903|gb|AFG69309.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171905|gb|AFG69310.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171907|gb|AFG69311.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171909|gb|AFG69312.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171911|gb|AFG69313.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171913|gb|AFG69314.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171915|gb|AFG69315.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171917|gb|AFG69316.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171919|gb|AFG69317.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171921|gb|AFG69318.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171923|gb|AFG69319.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171925|gb|AFG69320.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171927|gb|AFG69321.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171929|gb|AFG69322.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171931|gb|AFG69323.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171933|gb|AFG69324.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] gi|383171935|gb|AFG69325.1| hypothetical protein CL2191Contig1_03, partial [Pinus taeda] Length = 43 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+TRSL+++NRDKFTQNLT+FRH+FRVK Sbjct: 10 FDKLMADVTRSLEARNRDKFTQNLTIFRHEFRVK 43 >ref|XP_001772700.1| predicted protein [Physcomitrella patens] gi|162675925|gb|EDQ62414.1| predicted protein [Physcomitrella patens] Length = 1054 Score = 63.9 bits (154), Expect = 3e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+TR+L+ KNRDKFTQNLTVFRHDFR K Sbjct: 1021 FDKLMADVTRTLEPKNRDKFTQNLTVFRHDFRAK 1054 >ref|XP_001784686.1| predicted protein [Physcomitrella patens] gi|162663758|gb|EDQ50505.1| predicted protein [Physcomitrella patens] Length = 1054 Score = 63.9 bits (154), Expect = 3e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+TR+L+ KNRDKFTQNLTVFRHDFR K Sbjct: 1021 FDKLMADVTRTLEPKNRDKFTQNLTVFRHDFRAK 1054 >ref|XP_007137339.1| hypothetical protein PHAVU_009G118700g [Phaseolus vulgaris] gi|561010426|gb|ESW09333.1| hypothetical protein PHAVU_009G118700g [Phaseolus vulgaris] Length = 1051 Score = 63.5 bits (153), Expect = 4e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+T S+DSKNRDKFTQNLTVFRH+FR K Sbjct: 1018 FDKLMADVTLSIDSKNRDKFTQNLTVFRHEFRAK 1051 >ref|XP_006577895.1| PREDICTED: exportin-7-B-like isoform X3 [Glycine max] Length = 1019 Score = 63.2 bits (152), Expect = 5e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 583 FDKLMVDITRSLDSKNRDKFTQNLTVFRHDFRVK 482 FDKLM D+T S+DSKNRDKFTQNLT+FRH+FR K Sbjct: 986 FDKLMADVTLSIDSKNRDKFTQNLTIFRHEFRAK 1019