BLASTX nr result
ID: Mentha24_contig00012818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00012818 (614 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61793.1| arginine decarboxylase [Genlisea aurea] 60 5e-07 >gb|EPS61793.1| arginine decarboxylase [Genlisea aurea] Length = 715 Score = 60.1 bits (144), Expect = 5e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 511 MPALACCVDAAVSPPPYGFASWDSTLPEIPPPAT 612 MPALACCVD+AVSPPPY FASWDS+LP I A+ Sbjct: 1 MPALACCVDSAVSPPPYAFASWDSSLPAINAAAS 34