BLASTX nr result
ID: Mentha24_contig00012722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00012722 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273486.1| PREDICTED: chaperone activity of bc1 complex... 57 3e-06 emb|CAN70923.1| hypothetical protein VITISV_018909 [Vitis vinifera] 57 3e-06 >ref|XP_002273486.1| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial [Vitis vinifera] gi|297744068|emb|CBI37038.3| unnamed protein product [Vitis vinifera] Length = 583 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = -2 Query: 151 RRKPRERRVPSTPFSRXXXXXXXXXXXXXGTVQESAKRIMFGTP 20 RRKPRERRVPSTPFSR GT+QESAKRI+FGTP Sbjct: 126 RRKPRERRVPSTPFSRALGFAGLGVGIAWGTIQESAKRIVFGTP 169 >emb|CAN70923.1| hypothetical protein VITISV_018909 [Vitis vinifera] Length = 622 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = -2 Query: 151 RRKPRERRVPSTPFSRXXXXXXXXXXXXXGTVQESAKRIMFGTP 20 RRKPRERRVPSTPFSR GT+QESAKRI+FGTP Sbjct: 114 RRKPRERRVPSTPFSRALGFAGLGVGIAWGTIQESAKRIVFGTP 157