BLASTX nr result
ID: Mentha24_contig00012632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00012632 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26552.1| hypothetical protein MIMGU_mgv1a017391mg [Mimulus... 100 3e-19 ref|XP_004242882.1| PREDICTED: mitochondrial import receptor sub... 97 2e-18 sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import recep... 97 2e-18 gb|EPS63209.1| hypothetical protein M569_11578 [Genlisea aurea] 92 6e-17 ref|XP_006360661.1| PREDICTED: mitochondrial import receptor sub... 91 2e-16 ref|XP_004240126.1| PREDICTED: mitochondrial import receptor sub... 90 4e-16 ref|NP_001043627.1| Os01g0626300 [Oryza sativa Japonica Group] g... 89 8e-16 ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [S... 89 8e-16 gb|ABK21382.1| unknown [Picea sitchensis] 89 8e-16 ref|XP_007225789.1| hypothetical protein PRUPE_ppa014339mg [Prun... 88 1e-15 ref|XP_004969224.1| PREDICTED: mitochondrial import receptor sub... 88 1e-15 ref|XP_006372198.1| Mitochondrial import receptor subunit TOM7 f... 88 1e-15 ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1... 87 2e-15 ref|XP_004299770.1| PREDICTED: mitochondrial import receptor sub... 86 4e-15 ref|XP_006477861.1| PREDICTED: mitochondrial import receptor sub... 86 5e-15 ref|XP_006442420.1| hypothetical protein CICLE_v10023194mg [Citr... 86 5e-15 gb|AFK44684.1| unknown [Lotus japonicus] 86 5e-15 ref|XP_004151870.1| PREDICTED: mitochondrial import receptor sub... 85 9e-15 ref|XP_003525317.1| PREDICTED: mitochondrial import receptor sub... 85 9e-15 ref|XP_006644392.1| PREDICTED: mitochondrial import receptor sub... 85 1e-14 >gb|EYU26552.1| hypothetical protein MIMGU_mgv1a017391mg [Mimulus guttatus] Length = 78 Score = 100 bits (248), Expect = 3e-19 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -3 Query: 337 SLAAAGKFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 S+A A KFVKEWSTWTMKKAKV+THYGFIPLVIIIGMNS+PKPS+SQLLSPV Sbjct: 27 SVAVAAKFVKEWSTWTMKKAKVITHYGFIPLVIIIGMNSDPKPSLSQLLSPV 78 >ref|XP_004242882.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum lycopersicum] Length = 77 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = -3 Query: 337 SLAAAGKFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 ++AA GKFVKEW TW+ KKAKV+THYGFIPLVIIIGMNSEPKPS+SQLLSPV Sbjct: 26 AVAAVGKFVKEWGTWSAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 77 >sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import receptor subunit TOM7-1; AltName: Full=Translocase of outer membrane 7 kDa subunit 1 gi|3319774|emb|CAA76125.1| TOM7 protein [Solanum tuberosum] Length = 72 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -3 Query: 337 SLAAAGKFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 ++A GKFVKEW TWT KKAKV+THYGFIPLVIIIGMNSEPKPS+SQLLSPV Sbjct: 21 AVAVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 72 >gb|EPS63209.1| hypothetical protein M569_11578 [Genlisea aurea] Length = 81 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = -3 Query: 337 SLAAAGKFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 S AAA K VK+WS W +KKAKV+THYGFIPL+IIIGMNSEPKPSISQLLSPV Sbjct: 30 SAAAATKLVKQWSNWGLKKAKVITHYGFIPLIIIIGMNSEPKPSISQLLSPV 81 >ref|XP_006360661.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum tuberosum] Length = 78 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/52 (78%), Positives = 47/52 (90%) Frame = -3 Query: 337 SLAAAGKFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 ++ A FVK+WSTWT KKAKV+THYGFIPLVII+GMNSEPKPS+SQLLSPV Sbjct: 27 AVTAVYTFVKDWSTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 78 >ref|XP_004240126.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum lycopersicum] Length = 78 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = -3 Query: 337 SLAAAGKFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 ++ A FVK+W+TWT KKAKV+THYGFIPLVII+GMNSEPKPS+SQLLSPV Sbjct: 27 AVTAVYTFVKDWTTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 78 >ref|NP_001043627.1| Os01g0626300 [Oryza sativa Japonica Group] gi|11761083|dbj|BAB19073.1| TOM7-like protein [Oryza sativa Japonica Group] gi|54290251|dbj|BAD61183.1| TOM7-like protein [Oryza sativa Japonica Group] gi|113533158|dbj|BAF05541.1| Os01g0626300 [Oryza sativa Japonica Group] gi|125526917|gb|EAY75031.1| hypothetical protein OsI_02929 [Oryza sativa Indica Group] gi|125571240|gb|EAZ12755.1| hypothetical protein OsJ_02673 [Oryza sativa Japonica Group] Length = 80 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/53 (71%), Positives = 47/53 (88%) Frame = -3 Query: 340 SSLAAAGKFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 S+ AAA +FVKEW+TWTMKK KV HYGFIPL+I++GM SEP+PS++QLLSPV Sbjct: 28 STAAAAVRFVKEWTTWTMKKTKVAAHYGFIPLIIVVGMRSEPRPSLAQLLSPV 80 >ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] gi|241930169|gb|EES03314.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] Length = 79 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/53 (75%), Positives = 46/53 (86%) Frame = -3 Query: 340 SSLAAAGKFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 ++ A + VKEW+TWTMKKAKVV HYGFIPLVI+IGMNSEPKPS+ QLLSPV Sbjct: 27 TAAATTVRLVKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQLLSPV 79 >gb|ABK21382.1| unknown [Picea sitchensis] Length = 72 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -3 Query: 328 AAGKFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 +A K VKEW+TW MK+AK VTHYGFIPLVIIIGMNSEPKPSI+QLLSPV Sbjct: 24 SATKAVKEWTTWVMKRAKTVTHYGFIPLVIIIGMNSEPKPSIAQLLSPV 72 >ref|XP_007225789.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] gi|462422725|gb|EMJ26988.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] Length = 73 Score = 88.2 bits (217), Expect = 1e-15 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -3 Query: 313 VKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 VKEWSTW MKKAKVVTHYGFIPL+I+IGMNSEPKP +SQLLSPV Sbjct: 30 VKEWSTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPQLSQLLSPV 73 >ref|XP_004969224.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Setaria italica] Length = 82 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = -3 Query: 331 AAAGKFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 A A + VKEW+TWTMK AKV HYGFIPLVIIIGMNS+PKPSISQLLSPV Sbjct: 33 ATAVRLVKEWTTWTMKTAKVAAHYGFIPLVIIIGMNSDPKPSISQLLSPV 82 >ref|XP_006372198.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] gi|550318729|gb|ERP49995.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] Length = 74 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = -3 Query: 328 AAGKFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSP 185 +A ++VKEWSTWT KKAKV+THYGFIP++IIIGMNSEPKP I QLLSP Sbjct: 26 SASQYVKEWSTWTFKKAKVITHYGFIPMIIIIGMNSEPKPQIYQLLSP 73 >ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195606532|gb|ACG25096.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195637638|gb|ACG38287.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195658849|gb|ACG48892.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|223945683|gb|ACN26925.1| unknown [Zea mays] gi|413950686|gb|AFW83335.1| import receptor subunit TOM7-1 [Zea mays] Length = 79 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = -3 Query: 340 SSLAAAGKFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 ++ A + +KEW+TWTMKKAKVV HYGFIPLVI+IGMNSEPKPS+ QLLSPV Sbjct: 27 TAAATTVRLMKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQLLSPV 79 >ref|XP_004299770.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Fragaria vesca subsp. vesca] Length = 73 Score = 86.3 bits (212), Expect = 4e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -3 Query: 313 VKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 VKEW+ WTMKKAKVVTHYGFIPL+IIIGMNS+PKP +SQLLSPV Sbjct: 30 VKEWTNWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 73 >ref|XP_006477861.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Citrus sinensis] Length = 72 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 310 KEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 KEWSTWTMKKAKVVTHYGFIPL+IIIGMNS+PKP + QLLSPV Sbjct: 30 KEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 72 >ref|XP_006442420.1| hypothetical protein CICLE_v10023194mg [Citrus clementina] gi|557544682|gb|ESR55660.1| hypothetical protein CICLE_v10023194mg [Citrus clementina] Length = 72 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 310 KEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 KEWSTWTMKKAKVVTHYGFIPL+IIIGMNS+PKP + QLLSPV Sbjct: 30 KEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 72 >gb|AFK44684.1| unknown [Lotus japonicus] Length = 72 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/44 (84%), Positives = 43/44 (97%) Frame = -3 Query: 313 VKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 +KEW+TWTM+KAKVVTHYGFIPL+IIIGMNS+PKP +SQLLSPV Sbjct: 29 LKEWTTWTMRKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 72 >ref|XP_004151870.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] gi|449516268|ref|XP_004165169.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] Length = 73 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -3 Query: 328 AAGKFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 +A + KEW+TW +KKAKVVTHYGFIPLVIIIGMNSEPKP +SQLLSPV Sbjct: 25 SATQAFKEWTTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73 >ref|XP_003525317.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] Length = 72 Score = 85.1 bits (209), Expect = 9e-15 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = -3 Query: 328 AAGKFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 +A + +KEW+TW M+KAKV+THYGFIPLVIIIGMNS+PKP +SQLLSPV Sbjct: 24 SASECLKEWTTWAMRKAKVITHYGFIPLVIIIGMNSDPKPPLSQLLSPV 72 >ref|XP_006644392.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Oryza brachyantha] Length = 80 Score = 84.7 bits (208), Expect = 1e-14 Identities = 37/53 (69%), Positives = 46/53 (86%) Frame = -3 Query: 340 SSLAAAGKFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 182 S+ AAA +FVK W+TWTMKK KV HYGFIPL+I+IGM SEP+PS++QLL+PV Sbjct: 28 STAAAAMQFVKVWTTWTMKKTKVAAHYGFIPLIIVIGMRSEPRPSLAQLLTPV 80