BLASTX nr result
ID: Mentha24_contig00012609
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00012609 (502 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007016285.1| Uncharacterized protein isoform 2 [Theobroma... 57 4e-06 gb|EXC19362.1| hypothetical protein L484_010379 [Morus notabilis] 56 6e-06 >ref|XP_007016285.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508786648|gb|EOY33904.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 157 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = +3 Query: 3 YFRSSSSRTSEPDTDNQHKKNGGVDDSSGTNSTGASRGNWWEGSLYY 143 Y RSSS++TS + KK+GG DD +G NS ASRGNWW+GSLYY Sbjct: 113 YSRSSSTQTST--SYPIFKKDGGEDDPNGNNSQDASRGNWWQGSLYY 157 >gb|EXC19362.1| hypothetical protein L484_010379 [Morus notabilis] Length = 161 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/42 (54%), Positives = 29/42 (69%) Frame = +3 Query: 18 SSRTSEPDTDNQHKKNGGVDDSSGTNSTGASRGNWWEGSLYY 143 S RT ++ + KK+G DD +G NS ASRGNWW+GSLYY Sbjct: 120 SPRTRTTESQHSFKKDGSEDDPNGNNSNSASRGNWWQGSLYY 161