BLASTX nr result
ID: Mentha24_contig00012527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00012527 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37752.1| hypothetical protein MIMGU_mgv1a009200mg [Mimulus... 57 3e-06 >gb|EYU37752.1| hypothetical protein MIMGU_mgv1a009200mg [Mimulus guttatus] Length = 349 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/52 (55%), Positives = 39/52 (75%), Gaps = 3/52 (5%) Frame = -3 Query: 260 QTEITPAVTSSASLTVEVNSSKT---TIDEVIPQAAPKKAHALSPYINYEDL 114 +TEI P+ T S S ++EV+SS+T +I++VIPQ PKK + SPYINYEDL Sbjct: 114 KTEIAPSETISTSSSIEVDSSETATISINDVIPQIPPKKTNPSSPYINYEDL 165