BLASTX nr result
ID: Mentha24_contig00012379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00012379 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32391.1| hypothetical protein MIMGU_mgv1a005788mg [Mimulus... 62 1e-07 >gb|EYU32391.1| hypothetical protein MIMGU_mgv1a005788mg [Mimulus guttatus] Length = 470 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +1 Query: 1 DDSDLIGYTSTSVIVNEDDISFSDLEDDLDSTLPYKCKTSSNE 129 +DSDL+GY ST++I NE+DISFSDLEDD D T+P K K +S E Sbjct: 419 EDSDLVGYCSTTIIENEEDISFSDLEDDSDCTVPIKYKLASTE 461