BLASTX nr result
ID: Mentha24_contig00012312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00012312 (799 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006368958.1| ribosomal protein L19 [Populus trichocarpa] ... 70 9e-10 ref|XP_006359224.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 69 2e-09 ref|XP_004245816.1| PREDICTED: 50S ribosomal protein L19, chloro... 69 2e-09 ref|XP_007039708.1| Ribosomal protein L19 family protein [Theobr... 68 3e-09 gb|EYU19455.1| hypothetical protein MIMGU_mgv1a013552mg [Mimulus... 68 4e-09 gb|EXC02074.1| 50S ribosomal protein L19-1 [Morus notabilis] 68 4e-09 dbj|BAA97152.1| unnamed protein product [Arabidopsis thaliana] 68 4e-09 ref|XP_006477103.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 68 4e-09 ref|XP_006440191.1| hypothetical protein CICLE_v10021998mg [Citr... 68 4e-09 ref|XP_006414215.1| hypothetical protein EUTSA_v10026152mg [Eutr... 68 4e-09 ref|XP_006398416.1| hypothetical protein EUTSA_v10001011mg [Eutr... 68 4e-09 ref|XP_006284481.1| hypothetical protein CARUB_v10005667mg [Caps... 68 4e-09 ref|XP_006281041.1| hypothetical protein CARUB_v10027056mg [Caps... 68 4e-09 gb|ABD65070.1| plastid ribosomal protein L19, putative [Brassica... 68 4e-09 gb|ABD64915.1| plastid ribosomal protein L19, putative [Brassica... 68 4e-09 ref|XP_002870097.1| ribosomal protein L19 family protein [Arabid... 68 4e-09 ref|XP_002863352.1| hypothetical protein ARALYDRAFT_494259 [Arab... 68 4e-09 ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19, chloro... 68 4e-09 gb|ACF23041.1| ST10 [Eutrema halophilum] 68 4e-09 emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] 68 4e-09 >ref|XP_006368958.1| ribosomal protein L19 [Populus trichocarpa] gi|118483873|gb|ABK93827.1| unknown [Populus trichocarpa] gi|550347317|gb|ERP65527.1| ribosomal protein L19 [Populus trichocarpa] Length = 241 Score = 70.1 bits (170), Expect = 9e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+KHRKVRRARLYYLRDKLPRLSTFK Sbjct: 208 SPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 241 >ref|XP_006359224.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Solanum tuberosum] Length = 222 Score = 68.9 bits (167), Expect = 2e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKE+KV+KHRKVRRARLYYLRDKLPRLSTFK Sbjct: 189 SPNIKELKVVKHRKVRRARLYYLRDKLPRLSTFK 222 >ref|XP_004245816.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Solanum lycopersicum] Length = 214 Score = 68.9 bits (167), Expect = 2e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKE+KV+KHRKVRRARLYYLRDKLPRLSTFK Sbjct: 181 SPNIKELKVVKHRKVRRARLYYLRDKLPRLSTFK 214 >ref|XP_007039708.1| Ribosomal protein L19 family protein [Theobroma cacao] gi|508776953|gb|EOY24209.1| Ribosomal protein L19 family protein [Theobroma cacao] Length = 242 Score = 68.2 bits (165), Expect = 3e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+KHRKVRRARLYYLR+KLPRLSTFK Sbjct: 209 SPNIKEIKVVKHRKVRRARLYYLREKLPRLSTFK 242 >gb|EYU19455.1| hypothetical protein MIMGU_mgv1a013552mg [Mimulus guttatus] Length = 217 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEI+VL HRKVRRARLYYLRDKLPRLSTFK Sbjct: 184 SPNIKEIRVLSHRKVRRARLYYLRDKLPRLSTFK 217 >gb|EXC02074.1| 50S ribosomal protein L19-1 [Morus notabilis] Length = 265 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 201 SPNIKEIKVVNHRKVRRARLYYLRDKLPRLSTFK 234 >dbj|BAA97152.1| unnamed protein product [Arabidopsis thaliana] Length = 286 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 253 SPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 286 >ref|XP_006477103.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic-like [Citrus sinensis] Length = 236 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 203 SPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 236 >ref|XP_006440191.1| hypothetical protein CICLE_v10021998mg [Citrus clementina] gi|557542453|gb|ESR53431.1| hypothetical protein CICLE_v10021998mg [Citrus clementina] Length = 236 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 203 SPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 236 >ref|XP_006414215.1| hypothetical protein EUTSA_v10026152mg [Eutrema salsugineum] gi|557115385|gb|ESQ55668.1| hypothetical protein EUTSA_v10026152mg [Eutrema salsugineum] Length = 229 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 196 SPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 229 >ref|XP_006398416.1| hypothetical protein EUTSA_v10001011mg [Eutrema salsugineum] gi|557099505|gb|ESQ39869.1| hypothetical protein EUTSA_v10001011mg [Eutrema salsugineum] Length = 226 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 193 SPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 226 >ref|XP_006284481.1| hypothetical protein CARUB_v10005667mg [Capsella rubella] gi|482553186|gb|EOA17379.1| hypothetical protein CARUB_v10005667mg [Capsella rubella] Length = 227 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 194 SPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 227 >ref|XP_006281041.1| hypothetical protein CARUB_v10027056mg [Capsella rubella] gi|482549745|gb|EOA13939.1| hypothetical protein CARUB_v10027056mg [Capsella rubella] Length = 230 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 197 SPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 230 >gb|ABD65070.1| plastid ribosomal protein L19, putative [Brassica oleracea] Length = 224 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 191 SPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 224 >gb|ABD64915.1| plastid ribosomal protein L19, putative [Brassica oleracea] Length = 214 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 181 SPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 214 >ref|XP_002870097.1| ribosomal protein L19 family protein [Arabidopsis lyrata subsp. lyrata] gi|297315933|gb|EFH46356.1| ribosomal protein L19 family protein [Arabidopsis lyrata subsp. lyrata] Length = 225 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 192 SPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 225 >ref|XP_002863352.1| hypothetical protein ARALYDRAFT_494259 [Arabidopsis lyrata subsp. lyrata] gi|297309187|gb|EFH39611.1| hypothetical protein ARALYDRAFT_494259 [Arabidopsis lyrata subsp. lyrata] Length = 222 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 189 SPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 222 >ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19, chloroplastic [Vitis vinifera] gi|296088907|emb|CBI38456.3| unnamed protein product [Vitis vinifera] Length = 231 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 198 SPNIKEIKVVNHRKVRRARLYYLRDKLPRLSTFK 231 >gb|ACF23041.1| ST10 [Eutrema halophilum] Length = 136 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 103 SPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 136 >emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] Length = 231 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 799 SPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 698 SPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 198 SPNIKEIKVVNHRKVRRARLYYLRDKLPRLSTFK 231