BLASTX nr result
ID: Mentha24_contig00012071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00012071 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007038321.1| Major facilitator superfamily protein [Theob... 86 5e-15 ref|XP_003598179.1| Hexose carrier protein HEX6 [Medicago trunca... 86 5e-15 ref|XP_007038318.1| Major facilitator superfamily protein [Theob... 85 1e-14 ref|XP_004171208.1| PREDICTED: LOW QUALITY PROTEIN: hexose carri... 85 1e-14 ref|XP_004146943.1| PREDICTED: hexose carrier protein HEX6-like ... 85 1e-14 gb|EXC68592.1| Hexose carrier protein HEX6 [Morus notabilis] 84 2e-14 ref|XP_007148727.1| hypothetical protein PHAVU_005G009300g [Phas... 84 3e-14 gb|EYU20201.1| hypothetical protein MIMGU_mgv1a005029mg [Mimulus... 83 4e-14 ref|XP_007038317.1| Major facilitator superfamily protein, putat... 83 4e-14 ref|XP_004499623.1| PREDICTED: LOW QUALITY PROTEIN: hexose carri... 83 4e-14 ref|XP_003598178.1| Hexose carrier [Medicago truncatula] gi|3554... 82 6e-14 gb|ABK29440.1| sugar transport protein, partial [Coffea canephora] 82 6e-14 gb|EYU20200.1| hypothetical protein MIMGU_mgv1a004758mg [Mimulus... 82 8e-14 ref|XP_006490160.1| PREDICTED: hexose carrier protein HEX6-like ... 81 1e-13 ref|XP_007148729.1| hypothetical protein PHAVU_005G009500g [Phas... 81 1e-13 ref|XP_006421606.1| hypothetical protein CICLE_v10004781mg [Citr... 81 1e-13 ref|XP_003526372.1| PREDICTED: hexose carrier protein HEX6-like ... 81 1e-13 ref|XP_006582411.1| PREDICTED: hexose carrier protein HEX6-like ... 81 2e-13 ref|XP_003527549.1| PREDICTED: hexose carrier protein HEX6-like ... 81 2e-13 ref|XP_006490161.1| PREDICTED: hexose carrier protein HEX6-like ... 80 2e-13 >ref|XP_007038321.1| Major facilitator superfamily protein [Theobroma cacao] gi|508775566|gb|EOY22822.1| Major facilitator superfamily protein [Theobroma cacao] Length = 507 Score = 85.9 bits (211), Expect = 5e-15 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVGSD 129 GGWVVVMT FVY LLPETKNVPIEQMEKVW+ HWFWK+I+G + Sbjct: 457 GGWVVVMTAFVYFLLPETKNVPIEQMEKVWKEHWFWKRILGEE 499 >ref|XP_003598179.1| Hexose carrier protein HEX6 [Medicago truncatula] gi|355487227|gb|AES68430.1| Hexose carrier protein HEX6 [Medicago truncatula] Length = 510 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVG 123 GGWVVVMTVFVY LPETKNVP+EQMEKVW+ HWFWKKIVG Sbjct: 459 GGWVVVMTVFVYCFLPETKNVPLEQMEKVWQEHWFWKKIVG 499 >ref|XP_007038318.1| Major facilitator superfamily protein [Theobroma cacao] gi|508775563|gb|EOY22819.1| Major facilitator superfamily protein [Theobroma cacao] Length = 510 Score = 84.7 bits (208), Expect = 1e-14 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVG 123 GGWVV+MT FVY LPETKNVPIEQMEKVWR HWFWK+IVG Sbjct: 457 GGWVVLMTAFVYFFLPETKNVPIEQMEKVWREHWFWKRIVG 497 >ref|XP_004171208.1| PREDICTED: LOW QUALITY PROTEIN: hexose carrier protein HEX6-like [Cucumis sativus] Length = 513 Score = 84.7 bits (208), Expect = 1e-14 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVGSDKGGDRR 147 GGWVVVMTVFVY LPETKN+PIE++E+VWR HWFW+++VG D +R+ Sbjct: 457 GGWVVVMTVFVYYFLPETKNLPIEKVERVWREHWFWRRVVGEDDNEERK 505 >ref|XP_004146943.1| PREDICTED: hexose carrier protein HEX6-like [Cucumis sativus] Length = 513 Score = 84.7 bits (208), Expect = 1e-14 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVGSDKGGDRR 147 GGWVVVMTVFVY LPETKN+PIE++E+VWR HWFW+++VG D +R+ Sbjct: 457 GGWVVVMTVFVYYFLPETKNLPIEKVERVWREHWFWRRVVGEDDNEERK 505 >gb|EXC68592.1| Hexose carrier protein HEX6 [Morus notabilis] Length = 356 Score = 84.0 bits (206), Expect = 2e-14 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVGSD 129 GGWVVVMT FVY+ LPETKNVPIE+ME+VWR+HWFWK+ VG D Sbjct: 298 GGWVVVMTGFVYLFLPETKNVPIEKMERVWRNHWFWKRFVGQD 340 >ref|XP_007148727.1| hypothetical protein PHAVU_005G009300g [Phaseolus vulgaris] gi|561021991|gb|ESW20721.1| hypothetical protein PHAVU_005G009300g [Phaseolus vulgaris] Length = 516 Score = 83.6 bits (205), Expect = 3e-14 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVG 123 GGWVVVMT+FVY LLPETK+VP+EQMEKVW HWFWK+IVG Sbjct: 456 GGWVVVMTIFVYYLLPETKSVPLEQMEKVWHEHWFWKRIVG 496 >gb|EYU20201.1| hypothetical protein MIMGU_mgv1a005029mg [Mimulus guttatus] Length = 500 Score = 82.8 bits (203), Expect = 4e-14 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIV 120 GGWV VMTVFVY+LLPETKN+PIEQME VWR HWFWKK V Sbjct: 458 GGWVAVMTVFVYLLLPETKNIPIEQMEMVWREHWFWKKFV 497 >ref|XP_007038317.1| Major facilitator superfamily protein, putative [Theobroma cacao] gi|508775562|gb|EOY22818.1| Major facilitator superfamily protein, putative [Theobroma cacao] Length = 507 Score = 82.8 bits (203), Expect = 4e-14 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVG 123 GGWV VMT FVY+LLPETKNVPIE+MEKVWR HW WK+IVG Sbjct: 457 GGWVAVMTTFVYLLLPETKNVPIEKMEKVWREHWLWKRIVG 497 >ref|XP_004499623.1| PREDICTED: LOW QUALITY PROTEIN: hexose carrier protein HEX6-like [Cicer arietinum] Length = 537 Score = 82.8 bits (203), Expect = 4e-14 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIV 120 GGWVVVMTVFVY LPETKNVP+EQMEKVW+ HWFWK+IV Sbjct: 461 GGWVVVMTVFVYFFLPETKNVPLEQMEKVWQEHWFWKRIV 500 >ref|XP_003598178.1| Hexose carrier [Medicago truncatula] gi|355487226|gb|AES68429.1| Hexose carrier [Medicago truncatula] Length = 509 Score = 82.4 bits (202), Expect = 6e-14 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVG 123 GGWVV+MTVFVY LLPETKNVPIEQM++VWR H+FWK+IVG Sbjct: 458 GGWVVIMTVFVYFLLPETKNVPIEQMDRVWREHFFWKRIVG 498 >gb|ABK29440.1| sugar transport protein, partial [Coffea canephora] Length = 349 Score = 82.4 bits (202), Expect = 6e-14 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVGSDK 132 GGWV VMT FVY+LLPETKNVPIE+MEK+WR HWFWK+ V +D+ Sbjct: 296 GGWVTVMTAFVYLLLPETKNVPIERMEKIWREHWFWKRFVLNDE 339 >gb|EYU20200.1| hypothetical protein MIMGU_mgv1a004758mg [Mimulus guttatus] Length = 511 Score = 82.0 bits (201), Expect = 8e-14 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVGSD 129 GGW VMTVFVY LLPETKN+PIEQM+ +WR HWFWK+ VG D Sbjct: 458 GGWAAVMTVFVYFLLPETKNIPIEQMDGIWREHWFWKRFVGGD 500 >ref|XP_006490160.1| PREDICTED: hexose carrier protein HEX6-like [Citrus sinensis] Length = 505 Score = 81.3 bits (199), Expect = 1e-13 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVG 123 GGWV+VMT F+++ LPETKNVPIEQM+KVWR HWFWKK VG Sbjct: 459 GGWVIVMTTFMHLFLPETKNVPIEQMDKVWRQHWFWKKYVG 499 >ref|XP_007148729.1| hypothetical protein PHAVU_005G009500g [Phaseolus vulgaris] gi|561021993|gb|ESW20723.1| hypothetical protein PHAVU_005G009500g [Phaseolus vulgaris] Length = 522 Score = 81.3 bits (199), Expect = 1e-13 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVG 123 GGWVVVMTVFVY+LLPET+NVPIEQM++VWR H+FWK IVG Sbjct: 479 GGWVVVMTVFVYLLLPETRNVPIEQMDRVWREHFFWKTIVG 519 >ref|XP_006421606.1| hypothetical protein CICLE_v10004781mg [Citrus clementina] gi|557523479|gb|ESR34846.1| hypothetical protein CICLE_v10004781mg [Citrus clementina] Length = 511 Score = 81.3 bits (199), Expect = 1e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVG 123 GGWVVVMT FV+ LPETKNVPIEQM+KVW HWFWKKIVG Sbjct: 459 GGWVVVMTTFVHFFLPETKNVPIEQMDKVWGEHWFWKKIVG 499 >ref|XP_003526372.1| PREDICTED: hexose carrier protein HEX6-like [Glycine max] Length = 510 Score = 81.3 bits (199), Expect = 1e-13 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVG 123 GGWVVVMT FVY LPETK+VP+EQMEKVW+ HWFWK+IVG Sbjct: 459 GGWVVVMTTFVYYFLPETKSVPLEQMEKVWQEHWFWKRIVG 499 >ref|XP_006582411.1| PREDICTED: hexose carrier protein HEX6-like isoform X2 [Glycine max] Length = 453 Score = 80.9 bits (198), Expect = 2e-13 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVG 123 GGWVVVMT FVY+LLPET+NVPIEQM++VWR H+FWK+IVG Sbjct: 410 GGWVVVMTAFVYLLLPETRNVPIEQMDRVWREHFFWKRIVG 450 >ref|XP_003527549.1| PREDICTED: hexose carrier protein HEX6-like isoform X1 [Glycine max] Length = 501 Score = 80.9 bits (198), Expect = 2e-13 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVG 123 GGWVVVMT FVY+LLPET+NVPIEQM++VWR H+FWK+IVG Sbjct: 458 GGWVVVMTAFVYLLLPETRNVPIEQMDRVWREHFFWKRIVG 498 >ref|XP_006490161.1| PREDICTED: hexose carrier protein HEX6-like [Citrus sinensis] Length = 512 Score = 80.5 bits (197), Expect = 2e-13 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 1 GGWVVVMTVFVYILLPETKNVPIEQMEKVWRHHWFWKKIVG 123 GGW VVMTVFV+ LPETKNVPIE+M+KVWR HWFWK+IVG Sbjct: 460 GGWEVVMTVFVHFFLPETKNVPIERMDKVWREHWFWKRIVG 500