BLASTX nr result
ID: Mentha24_contig00012023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00012023 (541 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004236463.1| PREDICTED: pentatricopeptide repeat-containi... 62 7e-08 ref|XP_006364204.1| PREDICTED: pentatricopeptide repeat-containi... 59 8e-07 ref|XP_007216422.1| hypothetical protein PRUPE_ppa023053mg [Prun... 57 3e-06 ref|XP_003632809.1| PREDICTED: pentatricopeptide repeat-containi... 56 5e-06 >ref|XP_004236463.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Solanum lycopersicum] Length = 828 Score = 62.4 bits (150), Expect = 7e-08 Identities = 30/55 (54%), Positives = 38/55 (69%) Frame = +3 Query: 6 DSVSLAALLHGVCLVGKSKEWKSVIASKSIDAKLDVALKYLNIFEHYSTQELTNE 170 DSV+ AALLHG+CL GKSKEWKS+I+ +L VALKY IF+ Y + +E Sbjct: 746 DSVTFAALLHGICLNGKSKEWKSIISCSLSATELSVALKYSLIFDQYLSHGFNSE 800 >ref|XP_006364204.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like isoform X1 [Solanum tuberosum] gi|565397234|ref|XP_006364205.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like isoform X2 [Solanum tuberosum] Length = 816 Score = 58.9 bits (141), Expect = 8e-07 Identities = 28/55 (50%), Positives = 37/55 (67%) Frame = +3 Query: 6 DSVSLAALLHGVCLVGKSKEWKSVIASKSIDAKLDVALKYLNIFEHYSTQELTNE 170 DSV+ AALLHG+CL GK+KEWKS+I+ +L ALKY IF+ Y + +E Sbjct: 748 DSVTFAALLHGICLDGKAKEWKSIISCSLSATELSFALKYSLIFDQYLSHGFDSE 802 >ref|XP_007216422.1| hypothetical protein PRUPE_ppa023053mg [Prunus persica] gi|462412572|gb|EMJ17621.1| hypothetical protein PRUPE_ppa023053mg [Prunus persica] Length = 803 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/56 (48%), Positives = 38/56 (67%) Frame = +3 Query: 3 LDSVSLAALLHGVCLVGKSKEWKSVIASKSIDAKLDVALKYLNIFEHYSTQELTNE 170 LDSVS A LL+G+CL G+SKEWK++I+ D +L +LKYL + + Y Q +E Sbjct: 724 LDSVSFAGLLYGICLEGRSKEWKNIISFDLKDQELQTSLKYLLVLDDYLHQGRPSE 779 >ref|XP_003632809.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Vitis vinifera] Length = 879 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/50 (48%), Positives = 35/50 (70%) Frame = +3 Query: 6 DSVSLAALLHGVCLVGKSKEWKSVIASKSIDAKLDVALKYLNIFEHYSTQ 155 DSVS ALLHGVCL G+SKEWK++++ + +L +A+ Y +I + Y Q Sbjct: 742 DSVSFVALLHGVCLEGRSKEWKNIVSCNLNERELQIAVNYSSILDQYLPQ 791