BLASTX nr result
ID: Mentha24_contig00010930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00010930 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31097.1| hypothetical protein MIMGU_mgv1a002083mg [Mimulus... 64 3e-08 >gb|EYU31097.1| hypothetical protein MIMGU_mgv1a002083mg [Mimulus guttatus] Length = 718 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 156 MDMASKLQFLDLRSTFITGATPLSHSFPAALRPLH 52 MD+ASK+QF+DLRSTF+ G TPLSHSFPAALRP H Sbjct: 1 MDLASKIQFMDLRSTFLAGTTPLSHSFPAALRPHH 35