BLASTX nr result
ID: Mentha24_contig00010834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00010834 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28737.1| hypothetical protein MIMGU_mgv1a014034mg [Mimulus... 78 1e-12 ref|XP_007223470.1| hypothetical protein PRUPE_ppa011657mg [Prun... 77 2e-12 ref|NP_001241181.1| uncharacterized protein LOC100786093 [Glycin... 77 2e-12 ref|XP_003518721.1| PREDICTED: ran guanine nucleotide release fa... 77 2e-12 ref|XP_002522406.1| pentatricopeptide repeat-containing protein,... 76 4e-12 ref|XP_002524187.1| Nuclear import protein mog1, putative [Ricin... 75 7e-12 ref|XP_006366699.1| PREDICTED: probable ran guanine nucleotide r... 74 2e-11 ref|XP_007157638.1| hypothetical protein PHAVU_002G086500g [Phas... 74 2e-11 ref|XP_006438670.1| hypothetical protein CICLE_v10032771mg [Citr... 74 2e-11 ref|XP_004297310.1| PREDICTED: probable ran guanine nucleotide r... 74 3e-11 ref|XP_004490033.1| PREDICTED: ran guanine nucleotide release fa... 73 4e-11 ref|XP_002270902.2| PREDICTED: probable ran guanine nucleotide r... 73 5e-11 emb|CBI31975.3| unnamed protein product [Vitis vinifera] 73 5e-11 gb|EXB73285.1| hypothetical protein L484_009363 [Morus notabilis] 72 6e-11 ref|XP_002319123.1| hypothetical protein POPTR_0013s04750g [Popu... 72 6e-11 ref|XP_004228383.1| PREDICTED: probable ran guanine nucleotide r... 72 8e-11 ref|XP_004228382.1| PREDICTED: probable ran guanine nucleotide r... 72 8e-11 ref|XP_003613697.1| Ran guanine nucleotide release factor [Medic... 72 8e-11 ref|XP_007046145.1| Mog1/PsbP/DUF1795-like photosystem II reacti... 70 2e-10 ref|XP_004135179.1| PREDICTED: probable ran guanine nucleotide r... 69 7e-10 >gb|EYU28737.1| hypothetical protein MIMGU_mgv1a014034mg [Mimulus guttatus] Length = 203 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/50 (74%), Positives = 40/50 (80%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLFGDMA 213 IN SETAA VGAG+AVPA Q GCMPM +VF AVTSFKVNDW+LFG A Sbjct: 153 INAASETAAAVGAGVAVPAEQSGCMPMRQVFTSAVTSFKVNDWNLFGSSA 202 >ref|XP_007223470.1| hypothetical protein PRUPE_ppa011657mg [Prunus persica] gi|462420406|gb|EMJ24669.1| hypothetical protein PRUPE_ppa011657mg [Prunus persica] Length = 202 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLFGDMA 213 INPLSE+A+TVGAGLAVPA Q G MP+ EVF+ AV+SFKVNDW+LFG +A Sbjct: 153 INPLSESASTVGAGLAVPAVQSGYMPVAEVFKLAVSSFKVNDWNLFGSVA 202 >ref|NP_001241181.1| uncharacterized protein LOC100786093 [Glycine max] gi|255642279|gb|ACU21404.1| unknown [Glycine max] Length = 198 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLF 225 INPLSE+A TVGAG+AVPAAQ GCMPM+EVF+ AVTSF+V+DW LF Sbjct: 153 INPLSESADTVGAGVAVPAAQAGCMPMDEVFKLAVTSFRVHDWGLF 198 >ref|XP_003518721.1| PREDICTED: ran guanine nucleotide release factor-like isoform X1 [Glycine max] gi|571439592|ref|XP_006574902.1| PREDICTED: ran guanine nucleotide release factor-like isoform X2 [Glycine max] gi|571439594|ref|XP_006574903.1| PREDICTED: ran guanine nucleotide release factor-like isoform X3 [Glycine max] Length = 198 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLF 225 INP SE+A TVGAG+AVPAAQ GCMPMEEVF+ AVTSF+V+DW LF Sbjct: 153 INPFSESADTVGAGVAVPAAQAGCMPMEEVFKLAVTSFRVHDWGLF 198 >ref|XP_002522406.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538291|gb|EEF39898.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 130 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLFGDMA 213 INPLSETA TVGAG+A PAAQ G +PM EVF+ AV++FKVNDW+LFG A Sbjct: 80 INPLSETARTVGAGMAAPAAQSGFLPMSEVFKLAVSTFKVNDWNLFGSAA 129 >ref|XP_002524187.1| Nuclear import protein mog1, putative [Ricinus communis] gi|223536556|gb|EEF38202.1| Nuclear import protein mog1, putative [Ricinus communis] Length = 203 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLFGDMA 213 I+PLSETA TVGAG+A+PAAQ G +PM EVF+ AV++FKVNDW+LFG A Sbjct: 153 IHPLSETARTVGAGMAIPAAQSGFLPMSEVFKLAVSTFKVNDWNLFGSAA 202 >ref|XP_006366699.1| PREDICTED: probable ran guanine nucleotide release factor-like [Solanum tuberosum] Length = 203 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLFGDMA 213 INPLSE+A VGAG+AVPAAQ G MPM EVF+ AV+SFKV++WSLFG A Sbjct: 153 INPLSESATAVGAGMAVPAAQSGVMPMAEVFKLAVSSFKVHNWSLFGSAA 202 >ref|XP_007157638.1| hypothetical protein PHAVU_002G086500g [Phaseolus vulgaris] gi|561031053|gb|ESW29632.1| hypothetical protein PHAVU_002G086500g [Phaseolus vulgaris] Length = 198 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLF 225 INPLSE+A TVGAG+AVPAAQ GC PM++VF+ AVTSF+V DWSLF Sbjct: 153 INPLSESADTVGAGVAVPAAQVGCTPMDDVFKLAVTSFRVLDWSLF 198 >ref|XP_006438670.1| hypothetical protein CICLE_v10032771mg [Citrus clementina] gi|568859299|ref|XP_006483178.1| PREDICTED: probable ran guanine nucleotide release factor-like [Citrus sinensis] gi|557540866|gb|ESR51910.1| hypothetical protein CICLE_v10032771mg [Citrus clementina] Length = 204 Score = 74.3 bits (181), Expect = 2e-11 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLFGDMA 213 INPLSE+A+TVGAGL VPA Q G M M EVF+ AV+SFKVNDWSLFG A Sbjct: 153 INPLSESASTVGAGLPVPATQSGFMQMSEVFKLAVSSFKVNDWSLFGGTA 202 >ref|XP_004297310.1| PREDICTED: probable ran guanine nucleotide release factor-like [Fragaria vesca subsp. vesca] Length = 202 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLFG 222 INPLSE+A+TVGAG+A PA Q G +PM EVFR AV+SFKVNDW+LFG Sbjct: 153 INPLSESASTVGAGIAAPALQSGHVPMVEVFRVAVSSFKVNDWNLFG 199 >ref|XP_004490033.1| PREDICTED: ran guanine nucleotide release factor-like isoform X1 [Cicer arietinum] gi|502093731|ref|XP_004490034.1| PREDICTED: ran guanine nucleotide release factor-like isoform X2 [Cicer arietinum] gi|502093734|ref|XP_004490035.1| PREDICTED: ran guanine nucleotide release factor-like isoform X3 [Cicer arietinum] Length = 198 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLF 225 INP SE+A TVGAG+AVPAAQ GCM M+EVF+ AVTSFKV DW LF Sbjct: 153 INPFSESADTVGAGMAVPAAQAGCMSMDEVFKLAVTSFKVYDWGLF 198 >ref|XP_002270902.2| PREDICTED: probable ran guanine nucleotide release factor-like [Vitis vinifera] Length = 267 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLFG 222 INP S++A TVGAGL VPA Q G MPM EVF+ AV+SFKVNDWSLFG Sbjct: 219 INPFSDSAGTVGAGLPVPAEQSGHMPMTEVFKMAVSSFKVNDWSLFG 265 >emb|CBI31975.3| unnamed protein product [Vitis vinifera] Length = 216 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLFG 222 INP S++A TVGAGL VPA Q G MPM EVF+ AV+SFKVNDWSLFG Sbjct: 168 INPFSDSAGTVGAGLPVPAEQSGHMPMTEVFKMAVSSFKVNDWSLFG 214 >gb|EXB73285.1| hypothetical protein L484_009363 [Morus notabilis] Length = 201 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/50 (68%), Positives = 39/50 (78%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLFGDMA 213 INPLSE+A+ VGAG + A Q GCMPM EVFR AV++FKV DWSLFG A Sbjct: 151 INPLSESASAVGAGFTIAATQSGCMPMAEVFRHAVSTFKVCDWSLFGSTA 200 >ref|XP_002319123.1| hypothetical protein POPTR_0013s04750g [Populus trichocarpa] gi|118483128|gb|ABK93471.1| unknown [Populus trichocarpa] gi|222857499|gb|EEE95046.1| hypothetical protein POPTR_0013s04750g [Populus trichocarpa] Length = 197 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLFGD 219 I+PLSE+AATVGAGL PAAQ G +PM EVF+ AV++FKVNDW+LFG+ Sbjct: 150 ISPLSESAATVGAGLPAPAAQSGFLPMAEVFKLAVSNFKVNDWNLFGN 197 >ref|XP_004228383.1| PREDICTED: probable ran guanine nucleotide release factor-like isoform 2 [Solanum lycopersicum] Length = 203 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLFGDMA 213 INPLSE+A VGAG+AVPAAQ G MPM EVF+ AV+SFKV++WSLF A Sbjct: 153 INPLSESATAVGAGMAVPAAQSGVMPMAEVFKLAVSSFKVHNWSLFSSAA 202 >ref|XP_004228382.1| PREDICTED: probable ran guanine nucleotide release factor-like isoform 1 [Solanum lycopersicum] Length = 221 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLFGDMA 213 INPLSE+A VGAG+AVPAAQ G MPM EVF+ AV+SFKV++WSLF A Sbjct: 171 INPLSESATAVGAGMAVPAAQSGVMPMAEVFKLAVSSFKVHNWSLFSSAA 220 >ref|XP_003613697.1| Ran guanine nucleotide release factor [Medicago truncatula] gi|355515032|gb|AES96655.1| Ran guanine nucleotide release factor [Medicago truncatula] Length = 402 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLF 225 INP SE+A TVGAG+AVPA+Q GCM M+EVF+ A TSFKV DWSLF Sbjct: 352 INPFSESADTVGAGMAVPASQAGCMSMDEVFKLAATSFKVYDWSLF 397 >ref|XP_007046145.1| Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family protein isoform 1 [Theobroma cacao] gi|508710080|gb|EOY01977.1| Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family protein isoform 1 [Theobroma cacao] Length = 201 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLF 225 I+PLS++A+ VGAGLAVPA Q G +PM EVF+ AVTSFKVNDWSLF Sbjct: 153 IHPLSQSASAVGAGLAVPAMQSGLVPMVEVFKLAVTSFKVNDWSLF 198 >ref|XP_004135179.1| PREDICTED: probable ran guanine nucleotide release factor-like [Cucumis sativus] gi|449478418|ref|XP_004155313.1| PREDICTED: probable ran guanine nucleotide release factor-like [Cucumis sativus] Length = 202 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -3 Query: 362 INPLSETAATVGAGLAVPAAQFGCMPMEEVFRGAVTSFKVNDWSLFG 222 INPLSE+A++VG+GLA PA+ G MPM EVF+ AV+SFKV DWSLFG Sbjct: 153 INPLSESASSVGSGLATPASHSGYMPMPEVFKLAVSSFKVCDWSLFG 199