BLASTX nr result
ID: Mentha24_contig00010273
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00010273 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597839.1| Monothiol glutaredoxin-S15 [Medicago truncat... 56 6e-06 ref|XP_003597838.1| Monothiol glutaredoxin-S15 [Medicago truncat... 56 6e-06 ref|XP_002303260.1| glutaredoxin family protein [Populus trichoc... 55 8e-06 >ref|XP_003597839.1| Monothiol glutaredoxin-S15 [Medicago truncatula] gi|355486887|gb|AES68090.1| Monothiol glutaredoxin-S15 [Medicago truncatula] gi|388493508|gb|AFK34820.1| unknown [Medicago truncatula] Length = 90 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 318 GEFVGGSDIILSMHQSGELKEKLKDFAGKQ 229 GEF+GGSDI+LSMHQSGELKEKLKD KQ Sbjct: 61 GEFIGGSDIVLSMHQSGELKEKLKDVVSKQ 90 >ref|XP_003597838.1| Monothiol glutaredoxin-S15 [Medicago truncatula] gi|355486886|gb|AES68089.1| Monothiol glutaredoxin-S15 [Medicago truncatula] gi|388510724|gb|AFK43428.1| unknown [Medicago truncatula] Length = 158 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 318 GEFVGGSDIILSMHQSGELKEKLKDFAGKQ 229 GEF+GGSDI+LSMHQSGELKEKLKD KQ Sbjct: 129 GEFIGGSDIVLSMHQSGELKEKLKDVVSKQ 158 >ref|XP_002303260.1| glutaredoxin family protein [Populus trichocarpa] gi|222840692|gb|EEE78239.1| glutaredoxin family protein [Populus trichocarpa] Length = 172 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -3 Query: 318 GEFVGGSDIILSMHQSGELKEKLKDFAGKQQ 226 GEF+GGSDII++MHQ+GELKEKL+D AGK++ Sbjct: 140 GEFIGGSDIIMNMHQTGELKEKLQDIAGKEE 170