BLASTX nr result
ID: Mentha24_contig00010010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00010010 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26908.1| hypothetical protein MIMGU_mgv1a005936mg [Mimulus... 65 8e-09 emb|CAN81742.1| hypothetical protein VITISV_040850 [Vitis vinifera] 61 2e-07 emb|CBI29146.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_002272806.1| PREDICTED: uncharacterized protein LOC100255... 60 2e-07 ref|XP_007218871.1| hypothetical protein PRUPE_ppa003230mg [Prun... 56 5e-06 >gb|EYU26908.1| hypothetical protein MIMGU_mgv1a005936mg [Mimulus guttatus] Length = 464 Score = 65.5 bits (158), Expect = 8e-09 Identities = 36/56 (64%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 9 DFEAPNSYYDAEEYRVQGHIEGVLF-DRVLYSSRIESGGLLLCGGAISYLPFASVL 173 D EA SYYDA EY +E VL DRV+Y S IESGGLLLCGGAIS PF SV+ Sbjct: 412 DLEATISYYDAGEY---SRVESVLLMDRVMYKSSIESGGLLLCGGAISVFPFGSVM 464 >emb|CAN81742.1| hypothetical protein VITISV_040850 [Vitis vinifera] Length = 724 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/52 (53%), Positives = 39/52 (75%), Gaps = 2/52 (3%) Frame = +3 Query: 24 NSYYDAEEYRVQGHIEGVLFDRVLYSSRIESGGLLLCGG--AISYLPFASVL 173 ++YYD ++Y ++ + +LFDRV Y +RIESG LLLCGG A+S PFASV+ Sbjct: 673 SNYYDIDDYNLKNPAQNLLFDRVFYKNRIESGSLLLCGGGTAVSASPFASVJ 724 >emb|CBI29146.3| unnamed protein product [Vitis vinifera] Length = 580 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/52 (53%), Positives = 39/52 (75%), Gaps = 2/52 (3%) Frame = +3 Query: 24 NSYYDAEEYRVQGHIEGVLFDRVLYSSRIESGGLLLCGG--AISYLPFASVL 173 ++YYD ++Y ++ + +LFDRV Y +RIESG LLLCGG A+S PFASV+ Sbjct: 529 SNYYDIDDYNLKNPAQNLLFDRVFYKNRIESGSLLLCGGGTAVSASPFASVI 580 >ref|XP_002272806.1| PREDICTED: uncharacterized protein LOC100255666 [Vitis vinifera] Length = 586 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/52 (53%), Positives = 39/52 (75%), Gaps = 2/52 (3%) Frame = +3 Query: 24 NSYYDAEEYRVQGHIEGVLFDRVLYSSRIESGGLLLCGG--AISYLPFASVL 173 ++YYD ++Y ++ + +LFDRV Y +RIESG LLLCGG A+S PFASV+ Sbjct: 535 SNYYDIDDYNLKNPAQNLLFDRVFYKNRIESGSLLLCGGGTAVSASPFASVI 586 >ref|XP_007218871.1| hypothetical protein PRUPE_ppa003230mg [Prunus persica] gi|462415333|gb|EMJ20070.1| hypothetical protein PRUPE_ppa003230mg [Prunus persica] Length = 591 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = +3 Query: 3 DTDFEAPNS-YYDAEEYRVQGHIEGVLFDRVLYSSRIESGGLLLCGGAIS 149 DT+ + S YYD EY +Q + +FDRVLY +RIESGG+LLCG IS Sbjct: 532 DTELQIVRSNYYDLGEYNLQAAAQSYMFDRVLYRNRIESGGILLCGNGIS 581